KEGG   Saccharibacillus sp. ATSA2: FFV09_17575Help
Entry
FFV09_17575       CDS       T06082                                 

Gene name
zapA
Definition
(GenBank) cell division protein ZapA
Organism
saca  Saccharibacillus sp. ATSA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZapA DUF4200 Golgin_A5 CENP-F_leu_zip KASH_CCD DUF1664
Motif
Other DBs
NCBI-ProteinID: QDH22491
UniProt: A0A4Y6V1J7
LinkDB All DBs
Position
4236799..4241112
Genome map
AA seq 1437 aa AA seqDB search
MAERKTVSVEIYGTSYKIFGSSQEYVKRVAHLVDERMSAIAAGHPRLDTVRIAVLAAVNM
AETNIVNQDLQERLDESLSRADRLETETAQLRERTAEQASAEEALRAENAKLAEADRELA
ARREELRKANAELERLNGQKRQLESKLAEAEKSGSASRDALQKAGRDLSAERAAKEGLSS
ELETARLELRQGEEALAHSRERAGAFEQELEELRARLAESESKREELELELGLLREEESR
LNELSAGLEARVSELQAAGERAAEESAALGAELSALQEAEARLRSEGEAAALRAGELEAG
LRALTEVRQQLETRVGELEDGETIWSEEHARLESELGETRMREQELSERYEEARGQLEEL
RGREAAEQTRRGELEAEIADARQTEQDLREERERLREATDVQRQEREALERRAAELAEAE
AARASENAALASELEAWTQRERSWQAEKDTFESLLEEAEASRGELNRAIEERQAETVRLG
GELETLGEGKQRLELELQTVSADKERLERELERLSGDRDRLAGELATLGESQSRLQQELE
AAAGEQARLQDELSAAASDRLRLEEELRSVREQKQLLEERLEAAQADTVRFETEQESLRG
DKRDLEERLERLTAEKDTLEQEWISLSEEKDRLNGEWSSASAERDRLAQELASLNGEKSG
LEAELRSAQDRIVSLDEEQTALSGRLAQYGEAEAAWELRRQELEQAAEERDARIAASALR
LGELEAAGRELEQVRVRLEDRVRELGESEEYLTGEAVRLEEEVTGLVGRERALQSEMRER
ETAAESLRSRIAELESERGTLQEQLRGERENAASLNAARTELEAGLAAARQEREALLADK
ESLSADLAAEREQGARQAEAEAALTLQLAALAESEAALADEKRALEGELEAARAEAGRLA
GSRERLEDELRGANDRIGELDAQREALEARLEARSRELEETTARLESRVGELGASEEALT
EEVLLLEEAKGGLEAKLAEAGRSLEALEQAQRDSAAQLDELRGQAGELAAERDTLAERLG
EAGQRERELADERASVQAELERVRGEHDSAVRRGGELSSELDGLRSHLAGLEQRLAQMSG
ELDRYAQLESEWTEERLRQERLTGDLEEQVGRLREQKEELERGLEALSAGQAERAREYAR
LENELAASGERERSAERRESDLEAQLAQARRAADQLNERAGGLEARIGGLEAELEQARLA
GSEAAEALEQARREAESVGEAEAQWQAERERLSSRVAEFGGREASWRIETARQRRELEEA
GERERSLVKQKNAAERKLEETVVRALQASGEQERLQEELRTLRESGRELEARSARLNAEL
EQLRASRGSWAEEKAELERQLSAARSDDRMPESHAPDIQAQSGQEPPDAAARQNELRQVT
EQYEVLSHQLRILHVEREMEKEKREEADREHAKLQQEYAALQKEYNEWMEMLEHEQR
NT seq 4314 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgaaaaacagtcagcgtagagatttacggaacgtcctataaaattttcggc
agcagccaggagtatgtgaagcgtgtcgcccacctggtcgacgagcgcatgagcgcgatc
gcggccggccatccgaggctcgatacggtgcggattgccgtgctcgccgcggtcaatatg
gccgagacgaacatcgtgaaccaggacttgcaggagcggcttgacgagtctctgtcgcgc
gccgatcgcctggagaccgagacggcgcagctgcgcgaacggacggcggagcaggcttcg
gccgaagaagcgctgcgcgccgagaacgccaagcttgcggaagcggaccgggaacttgcg
gctcgccgcgaagaactgcgcaaagcgaacgccgaactggaacggctgaacggacagaag
cggcagctcgagagcaaattggccgaagcggagaaaagcggcagcgcgtcgcgcgacgcg
ctgcaaaaagcgggccgcgatctctcggcggaacgcgcggccaaggaagggctgtccagc
gagctcgaaacggcccgtctggaacttcgccaaggcgaagaagcgctggcccacagccgc
gaacgggcgggagcgttcgaacaggaactcgaagaactgcgcgcccgcctggcggagagc
gagtcgaagcgcgaagaactggaactcgaactcggcctgctgcgcgaagaagagtcccgc
ctgaacgagctgagcgccgggctggaagcccgcgtctcggagctgcaagcggccggcgaa
cgcgcggccgaggagagtgctgcgcttggcgcggagctgtccgcgctgcaagaagccgaa
gcgcggctgcggagcgaaggcgaggcggctgcgctgcgcgccggggaactggaagcaggc
ctgcgcgcgctgacggaagtccgccagcagctggagacgagagtcggcgagctggaagac
ggcgagacgatctggagcgaagaacatgcgcgcctggaatcggaactcggcgagacgcga
atgcgcgagcaagaactgtccgagcggtacgaagaagcgcgcgggcagctcgaagagctg
cgcggacgggaagcggcggagcagacgcgccgcggcgaactggaagcggagattgcggac
gcgcggcagacggaacaggatctgcgcgaagagcgcgagcggctgcgcgaagcgacggac
gttcagcgtcaggaacgcgaagcgctcgagcgccgcgcggccgaattggcggaagccgaa
gcggcccgcgcttcggagaacgcggcgcttgcctctgaactcgaagcgtggacgcagcgc
gaaaggtcctggcaggcggagaaagacacgttcgaatcgctgcttgaggaagcggaagct
tcccgcggcgaactgaaccgtgcgatcgaagaacgccaggcggagacggttcgtctcggc
ggcgaactggagacgctcggcgaaggcaagcagcgcctggaactcgaactccagaccgta
tcggcggacaaagaacgtctggagcgggagttggaaagattgtccggggatcgggaccgg
ttggccggcgaattggcgaccctcggcgagagccaatcgcggctgcagcaggagttggaa
gccgcggcgggcgaacaagcccggctgcaggacgaactctcggctgcggcgtcggaccga
ctgcgtctggaagaagaactgcgttcggtccgcgagcagaagcagcttctggaagagcgg
cttgaagcggcgcaagcggacacagtccggttcgagaccgagcaagagtcgctgcgcggc
gacaagcgggatctggaagaacgtctggagcggctgacggccgaaaaggatacgctggaa
caagaatggatatcgctgagcgaagaaaaagatcgcctgaacggcgaatggtcgtcggcg
agcgccgagcgcgaccgtctggcgcaggagctggcctcgctgaacggcgagaagtccggc
cttgaagccgaactgcgcagcgcgcaggaccggattgtctccctggacgaagagcagacc
gccctcagcggacggcttgcgcagtatggggaagccgaagcggcatgggaacttcgccgc
caggaactggaacaagcggcggaagaacgcgacgcccggattgccgcatcggcactccgg
ctcggcgagctggaagccgcgggccgcgaactggaacaagtccgcgtccgcctggaagat
cgcgtgcgcgagctgggcgaaagcgaggagtatctgaccggcgaagcggttcgtctggaa
gaggaagtgaccgggcttgtcgggcgcgagcgcgcgctgcaaagcgagatgcgcgagcgc
gagacggcggcggagagcctgcggtcgcgcatcgcggagctcgaaagcgagcgcggaacg
ctgcaggagcagcttcgcggcgagcgggagaatgccgcgtcgctgaacgcggcccgaacc
gaactggaagccggccttgcggcggcgcggcaggagcgcgaagcgctgcttgcggacaag
gagtccctgtccgcggaccttgcggccgagcgcgaacaaggcgcgcggcaggcggaagcc
gaagcggcgctgacgctgcagttggcggcgctggccgagagcgaagccgcgcttgcggac
gagaagcgtgcgcttgaaggcgaattggaagcggcccgcgcggaagccgggcgtctggcc
gggagcagggagcgcctcgaagacgagctgcgcggcgcaaacgaccggatcggcgagctt
gacgctcagcgggaagcgctggaagcccgcctggaagcgcggagccgggaactggaagag
acgacggcgcgtctggaaagccgcgtcggcgaactgggcgcaagcgaagaggcgctgacc
gaagaagtgctgctgctcgaagaagcaaaaggcggcctcgaagcgaagctggccgaagcc
ggccgctcgctcgaagcgctggagcaggcgcagcgggattcggctgcgcagttggacgag
ctgcgcggacaagcgggcgaacttgcggccgagcgcgatacgctcgccgaacgcctcggc
gaagccgggcagcgcgagcgggagcttgcggacgagcgtgcaagcgtgcaggcggagctt
gagcgcgtgcgcggcgagcacgattccgcggtgcgccgcggcggcgagctgtccagcgag
ctggacgggctgcgcagccatctggccggacttgagcagcgcctggcgcagatgtccggg
gaactggaccggtacgcgcagctcgaaagcgaatggacggaagaacggctgcgccaggag
cgcctgacgggcgatctggaagaacaggtcggccgcctgcgcgagcagaaggaagaactg
gaacgcgggctcgaagcgctgagcgccgggcaagcggagcgggcgcgggaatacgcgcgg
ctggagaacgaactggctgcttccggcgaacgggaacgttccgcggaacgccgggaaagc
gaccttgaagcgcagcttgcgcaggcgcgccgcgcggcggaccagctgaacgaacgcgcc
ggcggtctggaagcgcggatcggcggattggaagccgagctggaacaagcgcggctcgcc
ggaagcgaagcggccgaagcgctggaacaagcgcgtcgggaagccgagagtgtgggcgaa
gccgaagcgcagtggcaggcggaacgcgaacggctgtcttcccgcgtggcggaattcggc
ggtcgcgaagcgtcgtggcgtatcgagacggcgcgccagcgccgcgaactggaagaagcc
ggcgaacgcgaacggtcgctcgtcaagcagaagaacgccgcggagcgcaagctggaagaa
acggtcgtacgcgccctgcaagcttccggcgaacaggagcggctgcaggaagaactgcgc
acgctgcgggagagcggccgggaactcgaagcgcgcagcgcccggctgaacgccgaactg
gaacagctgagagcaagccgcggcagctgggccgaagaaaaggccgaactggaacggcaa
ttgtccgccgcccggtcagacgaccggatgccagagagccatgcgccagatattcaggcg
caaagcgggcaggaaccgccggatgccgccgcccggcaaaacgaattgaggcaggtgacg
gagcagtatgaagttctttcccatcagctccgcattcttcatgtcgaacgcgaaatggag
aaagaaaagcgtgaagaggccgaccgggaacatgccaagctgcagcaggagtacgcggcg
ctgcaaaaagagtacaacgaatggatggaaatgctggaacacgagcagcggtaa

DBGET integrated database retrieval system