KEGG   Saccharomonospora sp. 31sw: EYD13_03220Help
Entry
EYD13_03220       CDS       T05928                                 

Gene name
pduF
Definition
(GenBank) Propanediol diffusion facilitator
  KO
K02440  glycerol uptake facilitator protein
Organism
sacc  Saccharomonospora sp. 31sw
Brite
KEGG Orthology (KO) [BR:sacc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sacc02000]
    EYD13_03220 (pduF)
Transporters [BR:sacc02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    EYD13_03220 (pduF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: QBQ59024
UniProt: A0A4P7C655
LinkDB All DBs
Position
complement(681608..682561)
Genome map
AA seq 317 aa AA seqDB search
MSVKDTRHQTSSLARLRSSTGGELLAEFLGTAVLILLGTGSVAVALAGLPGSGRQMDAFG
PGNWLIIAFGWGLAVTFGVYVAGGVSGAHINPAVTLAFAVRRQFPWVKVVPYWIAQVIGA
FAGAAVVYWVYADAINAFNAAEGFADRAESVPSFSIFATFPAEYFGGGVWGPLFDQIVGT
AILVLAIASLIDSRNQAPQSNFGPWVIGFVVVAIGLSFGTNAGYAINPARDFGPRLLAFF
AGWGDAALPGNGEWFSNYWWIPIAGPLIGGVVGILVYDLFIGQVLKAREMLPGAVEAPPP
GRVPEPTDETETRKSAE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaaggacacccgtcaccagaccagcagcttggccagactccgatcgagtacc
ggcggggagttgctggccgagttcctcggcacggcggtgctgattctgctcggcacaggt
tcggtcgccgtggcgctcgccggtctacccggatcaggacggcagatggacgccttcggt
ccgggaaactggttgatcatcgcattcggatgggggctcgccgtcacgttcggcgtctac
gtcgcgggcggggtcagtggtgcccacatcaaccccgcggtgacgctggcgttcgcggtg
cggcggcagttcccctgggtgaaagtggtgccgtactggatcgcgcaggtcatcggcgcc
ttcgcgggtgcggccgtcgtgtactgggtgtacgcggatgcgatcaacgcgttcaacgcg
gcggagggcttcgcggacagagccgagtcagtaccgagtttctccatcttcgcgaccttc
cccgccgagtacttcggaggtggggtctggggtccgttgttcgaccagatcgtcggtacg
gccatcctggttctggccatcgcgtccctcatcgacagccgtaaccaggcgccacagagc
aacttcggaccgtgggtcatcggtttcgttgtcgtggccatcgggttgagcttcggtacg
aacgccggatacgccatcaacccggcccgtgacttcggtccgcgcctgctggctttcttc
gccgggtggggcgacgcggcgttgcctggcaacggtgagtggttcagcaactactggtgg
ataccgatcgcgggcccgctcatcggcggtgtcgtcggcatcctcgtctacgacctgttc
atcggccaggtcctcaaggcgagggagatgctccccggtgcggtcgaggcgcccccgccc
ggccgggttcccgagcccaccgacgagaccgagacccgcaagtccgccgagtga

DBGET integrated database retrieval system