KEGG   Saccharomonospora sp. 31sw: EYD13_11805Help
Entry
EYD13_11805       CDS       T05928                                 

Gene name
pdhC2
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sacc  Saccharomonospora sp. 31sw
Pathway
sacc00010  Glycolysis / Gluconeogenesis
sacc00020  Citrate cycle (TCA cycle)
sacc00620  Pyruvate metabolism
sacc01100  Metabolic pathways
sacc01110  Biosynthesis of secondary metabolites
sacc01120  Microbial metabolism in diverse environments
sacc01130  Biosynthesis of antibiotics
sacc01200  Carbon metabolism
Module
sacc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sacc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EYD13_11805 (pdhC2)
   00020 Citrate cycle (TCA cycle)
    EYD13_11805 (pdhC2)
   00620 Pyruvate metabolism
    EYD13_11805 (pdhC2)
Enzymes [BR:sacc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EYD13_11805 (pdhC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: QBQ60714
LinkDB All DBs
Position
2541332..2542636
Genome map
AA seq 434 aa AA seqDB search
MPEITMPRLSDTMEEGVIVTWRKRVGDEVRRGDVVAEIETDKALMELEAYDDGVLERLLV
TEGDRAPIGTPIAIIGDGTGATAGPEPGPKPEHEPGPEPESPSPQEAPAASAPANGDRGG
AAPARTRPKASPLARKIAREHGIELAAVEGSGPGGRIIRKDVEAAITAVNAATAATSATA
APASVAEPAVADPVPGAATGAPSTADYEEVPLTTIQRVAARRLTESKQQAPHFYLTAAVD
VTDLLAFRATLNDTLTASGGPKISLNDLVVRAVAVALRADPSVNVSFAGDRVLRHRGVHL
GVAVAVPDGLVVPVVRDADRKSVSEIAEETREKAGRARDGRLRADELTGGTFTISNLGMF
GIEQFAAVINPPEAAILAVGAVSEELRLADGEVVARSILRVTLSADHRAVDGATGATFLR
RLRDLLENPLRIVA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagatcaccatgccccggctctccgacacgatggaggagggcgtcatcgtcacc
tggcgcaagcgggtgggcgacgaggtccgtcgcggcgacgtcgtcgcagagatcgagacg
gacaaggccctcatggagttggaggcctacgacgacggtgtgctcgaacgcctcctcgtc
accgagggcgaccgcgctcccatcggaacccccatcgcgatcatcggtgacggcaccggc
gcgaccgcagggccggaacccgggccgaagccggaacacgagcccggacccgagccggaa
tccccctcgccccaggaggcaccggccgcctcggcaccggcgaacggagaccggggcggc
gcggccccggcgcggacccggcccaaggcgtccccgctcgcccgcaagatcgcccgcgag
cacgggatcgagctggcggccgtcgagggcagcggccccggtggccggatcatccgcaag
gacgtcgaggccgccatcaccgccgtcaacgcagccaccgccgcgaccagcgcgaccgcc
gcgcccgcgtccgtcgccgaacccgccgtcgcggacccggttcccggtgccgcgacgggc
gctccgtccacagcggactacgaggaggtcccgctcaccacgatccagcgggtggcggcc
cggcggttgaccgagagcaagcagcaggctccgcacttctacctcaccgccgccgtcgat
gtcacagacctactggcgttccgcgcgaccctcaacgacaccctcacagcgtcgggcggc
ccgaagatcagcctcaacgacctcgtcgtgagggcggtcgcggtcgccctgcgtgccgac
ccctcggtcaacgtgtcgttcgcgggtgaccgggtgctgcggcaccgcggcgttcacctc
ggcgtcgcggtggcggtaccggacgggctggtggtccctgtcgtccgcgacgccgaccgc
aagagcgtgtccgagatcgccgaggagacaagggagaaggcgggccgcgccagggatggc
aggctccgtgccgacgagctgaccggcggcacgttcaccatctccaacctcggcatgttc
ggcatcgagcagttcgcggcggtgatcaacccgccggaagccgccatcctcgccgtcggt
gccgtctcggaggaactgcgtctcgccgacggcgaggtcgtcgcacgctcgattctgcga
gtgaccctgtcggccgaccacagggccgtggacggcgccacgggcgcgacgttcctgcga
cggctgagggacctgctggagaacccgctgcgcatcgtggcgtga

DBGET integrated database retrieval system