KEGG   Saccharomonospora sp. 31sw: EYD13_16770Help
Entry
EYD13_16770       CDS       T05928                                 

Gene name
davT
Definition
(GenBank) 5-aminovalerate aminotransferase DavT
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sacc  Saccharomonospora sp. 31sw
Pathway
sacc00250  Alanine, aspartate and glutamate metabolism
sacc00410  beta-Alanine metabolism
sacc00640  Propanoate metabolism
sacc00650  Butanoate metabolism
sacc01100  Metabolic pathways
sacc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sacc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EYD13_16770 (davT)
   00650 Butanoate metabolism
    EYD13_16770 (davT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EYD13_16770 (davT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EYD13_16770 (davT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sacc01007]
    EYD13_16770 (davT)
Enzymes [BR:sacc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EYD13_16770 (davT)
Amino acid related enzymes [BR:sacc01007]
 Aminotransferase (transaminase)
  Class III
   EYD13_16770 (davT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: QBQ61698
UniProt: A0A4P7CAL0
LinkDB All DBs
Position
3638096..3639349
Genome map
AA seq 417 aa AA seqDB search
MAQLSPILKQATPVVVDHGEGAYLYDTSGRRHLDFTAGIGVTSTGHCHPRVVAAAQEQVG
KLIHGQYTTVMHKPLLELGERLGEVLPKGLDSLFFANSGSEAVEAALRLTRQATGRPNVV
VFQGGFHGRTVAAASMTTSGTRFSAGFSPLMSGVHVAPFPYAYHYGWDERTATDFALREL
DYLFATQTSPQETAAFFIEPMLGEGGYVPANTEFMAGLRRRADEHGILLVIDEIQTGFGR
TGRFWGHEHFDVRPDVVLIAKGLASGFPLSGIAASKDLMGKAWPGSQGGTYGGNAVSCAA
AIATLDVIKEENLVENAAARGRQLLDGAKAVGDKTPGIGDVRGLGLLVGSEFVTPDGKPD
TATAQAAQKAAAEKGLLLLTCGAFMNVVRMIPPLVVTSEQIEEALEIWTDVVASVTA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctttccccgatcctcaagcaggccaccccggtcgtcgtcgatcacggcgaa
ggcgcctatctctacgacaccagcggacgacgccacctcgacttcacagcgggtatcggc
gtgaccagcaccgggcactgccacccccgcgtcgtggccgccgcgcaggagcaggtcggc
aagctgatccacggccagtacaccaccgtgatgcacaagcccctcctcgaactcggcgaa
cggctcggcgaggtgctgccgaagggcctcgactcgctcttcttcgccaactccggcagt
gaagccgtcgaggccgcgctccgcctgaccaggcaggcaacggggcgacccaacgtggtc
gtgttccagggcggcttccacggccgcacggtggcggcagcgtcgatgacgacgtcggga
acccgcttcagcgccggtttctccccgctgatgagcggcgtgcacgtggcgccgttcccc
tacgcctaccactacggctgggacgagcggacggcgacggacttcgcactgcgcgaactg
gactaccttttcgccacgcagacctcgccgcaggagacggccgcgttcttcatcgagccg
atgctgggcgagggcggctacgtgcccgcgaacaccgaattcatggccgggctgcggcgg
cgggccgacgagcacggcattctcctcgtcattgacgagatccagaccggtttcgggcgc
accggcaggttctggggccacgagcacttcgacgtgcgccccgacgtcgtgctcatcgcg
aagggcctcgccagcggcttcccgctctcgggcatcgccgcgtcgaaggacctcatgggc
aaggcgtggccgggttcgcagggaggcacctacggcggcaacgcggtctcgtgcgcggct
gccatcgccaccctcgacgtgatcaaggaggagaacctcgtcgagaacgcggcggcgcgg
ggcaggcaactgctcgacggcgcgaaggcggtcggcgacaaaacgccgggcatcggtgac
gtgcgcgggctcggcctgctggtcgggtccgagttcgtgacgcccgacggcaagcccgac
accgcgaccgcgcaggcggcgcagaaggcagcggcggagaaggggttgctgttgctcacc
tgcggcgcgttcatgaacgtcgtgcgcatgatcccgccgctggtcgtcaccagtgagcag
atcgaggaggcgctggagatctggaccgacgtcgtcgcctcggtcaccgcctga

DBGET integrated database retrieval system