KEGG   Saccharopolyspora coralli: GIY23_10610
Entry
GIY23_10610       CDS       T06288                                 

Definition
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sace  Saccharopolyspora coralli
Pathway
sace00250  Alanine, aspartate and glutamate metabolism
sace00410  beta-Alanine metabolism
sace00640  Propanoate metabolism
sace00650  Butanoate metabolism
sace01100  Metabolic pathways
sace01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GIY23_10610
   00650 Butanoate metabolism
    GIY23_10610
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GIY23_10610
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GIY23_10610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sace01007]
    GIY23_10610
Enzymes [BR:sace01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     GIY23_10610
Amino acid related enzymes [BR:sace01007]
 Aminotransferase (transaminase)
  Class III
   GIY23_10610
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: QGK69910
UniProt: A0A5Q3Q7W1
LinkDB
Position
2241753..2243003
AA seq 416 aa
MAELSPVLKQATPVLASRGDGVHVYDEDDRQYLDFTAGIGVTSTGHCHPRVVEAAQKQVG
TLIHGQYTTIMHRPLLDLTQRLGEVLPTGLDRLFYVNSGSEAVEASVRLARQATGRQNVI
AFHGGFHGRTMGAGALTTSGTKIRAGIGPMMPGTVFAPFPEAYRQGWSEEQAVRFALREL
DHVLATVSAPQDTAALLVEPVLGEGGYIPAPAAFLQGLRERADKLGAVLILDEVQTGVGR
TGTFWGHEPSGIHPDVVITAKGLASGFPISGIAAGEELMGKAWPGSQGGTYGGNAVAAAA
ALATLDVVRDENLVANAAEQGDRLMEGLRKVAAEHPVIGDVRGRGLMIGNEFTTADGEPD
GASAARAHAAAAERGLLLLTCGPHGNVVRMIPPLIVTAEQVDNAVGLWSESVAAAA
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggctgagctctcgccggtgctgaagcaggcgacgcccgtactggcctcccgcggggac
ggtgttcacgtctacgacgaggacgatcgccagtacctcgacttcaccgccgggatcggt
gtcaccagcaccggacactgccacccgcgggtcgtcgaggccgcccagaagcaggtgggc
accctcatccacggccagtacacgacgatcatgcaccgtccgctgctcgatctcacgcag
cgactcggggaggtgctgccgaccgggctcgaccggctgttctacgtcaactccggcagc
gaggccgtggaggcgtcggtgcggctggcgcggcaagcgaccgggcggcagaacgtcatc
gccttccacggcggtttccacggccgcaccatgggcgcgggcgcgctgaccacctcggga
accaagatccgcgccgggatcggcccgatgatgcccgggacggtgttcgccccgttcccg
gaggcctaccggcagggttggtcggaggagcaggcggtgcggttcgcgctgcgtgagctc
gaccatgtgttggccaccgtgtcggcaccgcaggacaccgccgcgctgctcgtcgagccg
gtgctcggtgagggcggctacatcccggcgcccgccgcgttcctgcagggactgcgggaa
cgtgcggacaagctcggtgcggtgctcattctggacgaggtgcagaccggtgtgggtcgt
accggcacgttctggggtcacgagccatccggcatccacccggacgtcgtcatcaccgcc
aagggcctggccagcgggttcccgatctccgggatcgccgccggcgaggaactcatgggc
aaggcgtggccgggctcgcagggcggcacctacggcggcaacgcggtcgcggccgccgcc
gcgctggccaccctcgacgtggtgcgcgacgagaacctggtggccaacgccgccgagcag
ggtgaccggctcatggagggactccgcaaggtcgccgccgagcacccggtgatcggtgac
gtgcgcggccgcggtctgatgatcggcaacgagttcaccaccgccgacggggaacccgac
ggcgcgagcgcggcgcgcgcgcacgcggcggccgccgagcgcggtctgctgctgctgacc
tgtgggccgcacggcaacgtggtgcggatgatcccgccgctgatcgtgaccgccgagcag
gtcgacaacgcggtggggctgtggtcggagtccgtcgccgctgcagcctga

DBGET integrated database retrieval system