KEGG   Saccharopolyspora sp. ASAGF58: FDZ84_27225
Entry
FDZ84_27225       CDS       T06538                                 

Definition
(GenBank) aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
sacg  Saccharopolyspora sp. ASAGF58
Pathway
sacg00997  Biosynthesis of various secondary metabolites - part 3
sacg01100  Metabolic pathways
sacg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sacg00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    FDZ84_27225
Enzymes [BR:sacg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     FDZ84_27225
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: QIZ37600
UniProt: A0A6H1RBU8
LinkDB
Position
complement(5827329..5828165)
AA seq 278 aa
MKQYLRHLPSARRLRLNRLFRNNPQRTLIVPLDHPLTDGPGAGRGASLNNLVGQLAANGA
DAVVLHKGNVRFVDPAWFKQLSLIVHLSASTVHAPDPDHKVLVGTVEEALRLGADLVSVH
VNIGSREEARQLGDLAAVAESCDRWNVPLLAMMYPRGPRITDPRDPEIVVHAVTVAAELG
ADMVKTYYVGSDDAMGRITSTSPIPIVVAGGLRTADEKDLLELVDGAMRGGAAGLAMGRN
IFQAPHPGNLTRKLAQRVHGDIVPAAPTELIAAQRDMA
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaagcaatatttacgccatttgccgtcggcgcgtcgtttacgcctcaaccgacttttt
cgaaataatccacaaaggacgttgatcgtcccgctcgaccatccactcaccgatggcccc
ggtgcgggccgcggggccagcctgaacaatctcgtcggccagctcgccgcgaatggcgcg
gacgccgtagtcctccacaaaggaaacgtgcgtttcgtcgacccggcctggttcaagcaa
ctgtctctgatcgtgcacctcagcgcgagcacagtgcacgcgccagacccggaccacaag
gtgctcgtcgggacggtcgaggaggcgctgcgactgggtgccgacttggtcagcgtgcac
gtgaacatcggttcccgcgaggaggcgcggcagctaggggatctggcggcggtggccgag
tcctgcgaccgctggaacgttccgctcctggccatgatgtacccccgcggtccgcggatc
accgatccgcgggaccccgagatcgtggtgcacgccgtaactgtggcggccgagctcgga
gccgacatggtgaagacctactacgtcggctcggacgatgcaatgggccggatcacctca
acgtcgccgattccgatcgtggtggctggcgggctgcgcaccgctgacgagaaagacctg
ctggagctcgtcgatggggcgatgcggggcggcgcggcagggctggccatgggccgcaac
attttccaggctccgcatcccggaaatctcacccggaagcttgcgcagcgggtgcacggc
gacatcgtgccggccgctccgaccgagctgattgcagcccagcgggacatggcgtaa

DBGET integrated database retrieval system