KEGG   Saccharopolyspora sp. ASAGF58: FDZ84_31650
Entry
FDZ84_31650       CDS       T06538                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sacg  Saccharopolyspora sp. ASAGF58
Pathway
sacg00250  Alanine, aspartate and glutamate metabolism
sacg00410  beta-Alanine metabolism
sacg00640  Propanoate metabolism
sacg00650  Butanoate metabolism
sacg01100  Metabolic pathways
sacg01120  Microbial metabolism in diverse environments
Module
sacg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sacg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FDZ84_31650
   00650 Butanoate metabolism
    FDZ84_31650
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FDZ84_31650
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FDZ84_31650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sacg01007]
    FDZ84_31650
Enzymes [BR:sacg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     FDZ84_31650
Amino acid related enzymes [BR:sacg01007]
 Aminotransferase (transaminase)
  Class III
   FDZ84_31650
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: QIZ38269
UniProt: A0A6H1RFQ4
LinkDB
Position
complement(6710504..6711760)
AA seq 418 aa
MAELSPVLKQATPVLAARGEGVYLYDEQDRRYLDFTAGIGVTSTGHCHPRVVEAAQRQVG
TLIHGQYTTVMHRPLLRLTERLGEVLPTGLDRLFYVNSGSEAVEAAVRLARQATGRQNIV
AFQGGFHGRTMGAGALTSSGVKVRAGIGPMMPGVVFTPFPEAYRHRTSEAEAVRYALAEF
DQLLVTVSSPRDTAAIIIEPVLGEGGYIPAPPAFLAGLRERADRHGILLIVDEVQTGVGR
TGRFWGHDHAGIRPDILITAKGLASGFPLSAIAAPEDLMSQAWPGSQGGTYGGNAVAAAA
ALATLDVVRDEHLVENAAEQGARLQEGLRKVAAEHPVIGDVRGLGLMVGNEFSTPDGTPD
TATATRAHQAAAERGLLLLTCGPHGNVVRMIPPLIVTAEQVDDAVGLWAEAVRDAVNA
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggctgagctctcgccggtgctgaagcaggccacgccggtcctagccgcccgcggggaa
ggcgtctacctctacgacgagcaggatcgccgatacctggatttcaccgccgggatcggg
gtcaccagcacgggccactgccacccgcgcgtggtcgaggcggcccagcgccaggtgggt
accctcatccacggccagtacacgaccgtcatgcaccggccgctactgcggctgaccgaa
cgactcggcgaggtactgccgaccggcctggaccggctgttctacgtcaactccggcagc
gaagcggtcgaggcggcggtgcggctggcccgccaggccaccgggcggcagaacatcgtg
gccttccagggtggcttccacggtcgcacgatgggcgcgggcgcgctgaccagctccggg
gtcaaagtgcgggccgggatcggcccgatgatgcccggcgtggtgttcaccccgttcccg
gaggcttaccggcaccgcaccagcgaggccgaggcggtgcgctacgcgctggccgagttc
gaccagttgctggtcaccgtcagctcgccgcgtgacaccgccgcgatcatcatcgaaccg
gtgctcggcgagggcggctacatccccgcaccgccggcgttcctcgctggcctgcgggaa
cgcgccgaccggcacggaatcctgctcatcgtcgacgaggtgcagaccggtgtcggtcga
accggccgattctggggccacgaccacgccgggatccggcccgacatcctgatcaccgcc
aaggggctggccagcggtttcccgctgtcggccatcgccgcgccggaggacctgatgagc
caggcatggcctggctcgcagggcggcacatacggaggcaacgcggtggccgccgcggcg
gcgctggccaccctcgacgtggttcgcgacgagcacctcgtcgaaaacgccgccgagcag
ggcgcccggctacaggagggcctgcgcaaggtcgccgccgagcacccggtgatcggcgac
gtgcgcgggctgggcctgatggtcggcaacgagttcagcacgcccgatggcacgccggac
accgcgacggccacccgggcacaccaggccgccgccgagcgcgggctgctgctgctgacc
tgcggcccgcacggcaacgtggtgcggatgatcccgccgctgatcgtcaccgcagagcag
gtcgacgacgcggtcgggctgtgggcggaggcggtgcgggacgccgtcaacgcctga

DBGET integrated database retrieval system