KEGG   Singulisphaera acidiphila: Sinac_0168Help
Entry
Sinac_0168        CDS       T02393                                 

Definition
(GenBank) Cu/Zn superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
saci  Singulisphaera acidiphila
Brite
Enzymes [BR:saci01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sinac_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AGA24623
UniProt: L0D709
LinkDB All DBs
Position
206217..206813
Genome map
AA seq 198 aa AA seqDB search
MTRKSFVFAMATGAALVALTAIGSWAQHAEVPHLGGVTKAIAVLHATKKGGDVHGKVTFT
RTPKGILVEGTVEGLTPGLHGFHVHEFGDCSSDDAMSAGGHFNPTDMPHAGPHADKRHVG
DLGNIEANEKGVAKIDILDSALSFSGDHSIIGRGLIVHAKADDLKSAPAGAAGDRVACGV
IGVAKGAGMMSGSAPAKK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaagagctttgttttcgccatggcgaccggtgccgccttggtcgcgctgacc
gcgatcgggtcgtgggcccagcacgccgaggtgccccacctggggggagtgacgaaggca
atcgccgtgctgcacgccaccaagaaggggggtgacgttcatggcaaggtcaccttcaca
cggactccgaaggggatcctggtggaagggacggtcgagggtctgaccccgggcctgcac
ggcttccacgtccacgagtttggcgattgcagctcggacgacgccatgtccgcaggcggc
cacttcaatcccacggacatgccgcacgccggcccgcatgccgataagcggcacgtcggt
gacctcgggaacatcgaggccaacgagaagggtgtggccaagatcgacatcctcgactcc
gccctcagcttctccggcgaccactcgatcatcggtcgcggcctgatcgttcacgccaag
gccgacgacctcaagtccgcccccgccggcgcagccggtgaccgcgtcgcctgcggcgtc
atcggcgtcgccaagggcgccgggatgatgagcggctccgcgcccgccaagaagtga

DBGET integrated database retrieval system