KEGG   Singulisphaera acidiphila: Sinac_3788Help
Entry
Sinac_3788        CDS       T02393                                 

Definition
(GenBank) sugar phosphate isomerase/epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00040  Pentose and glucuronate interconversions
saci00053  Ascorbate and aldarate metabolism
saci01100  Metabolic pathways
saci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sinac_3788
   00053 Ascorbate and aldarate metabolism
    Sinac_3788
Enzymes [BR:saci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     Sinac_3788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: AGA28021
UniProt: L0DH78
LinkDB All DBs
Position
4740500..4741414
Genome map
AA seq 304 aa AA seqDB search
MSRPWKKGIVIRAFADSGDFLAGTAFLRTMEDYSRVFRRAKQAGFEAVQPYLELEGGLLH
LGTEPAQVREIASRAAAEGIDLPSLEIAPLQYSFTSDDPATRARGVDVVRRALAIAGELG
ARGILVIPGYVGKPWDPKTDQVDYEQAWDRTLAALRTLAPQAEAAGVTLLVEPIWNMFLL
SPLEMRRLVDEVGSPRCGVLLDTGNVTLFGFAEQWMRILGPRVKEIHLKDFRRQVGTIHG
FVPLLAGDVDWVALARAAEAAGFDGCWIAEQFPTERHGESVLDLTSAAMDRILGRLEPDG
VNPK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcccatggaagaaagggatcgtcatccgggcgttcgccgactcgggagacttc
ttggccgggaccgctttcctgcggaccatggaagactacagccgggtcttccggagggcg
aagcaggccggcttcgaggccgttcagccctacctcgagctcgaagggggattgctccac
cttggcaccgagcccgcacaagtccgcgagattgcctcccgggcggccgccgaagggatc
gacctgccgagtctcgagatcgcccctttgcagtattcgttcacgagcgacgacccggcg
acccgtgcccgaggggtcgacgttgtccggcgggccctcgcaatcgcaggagagctgggc
gcgcgtgggatccttgtcatccccggatatgtcgggaagccgtgggatccgaagaccgac
caggtcgactacgaacaggcttgggaccgcaccctcgccgcgctccgcaccctcgccccg
caggctgaggcggcgggagtcaccttgctggtggaaccgatctggaacatgttcctgctc
agcccgctcgagatgcgtcgcctggtcgacgaggtgggaagcccgcgctgcggggtcttg
cttgacacgggcaacgtcacgcttttcggcttcgccgagcaatggatgcggatcctcggc
ccgcgcgtgaaggagattcacctgaaggatttccgaaggcaggtgggcacgatccacggc
ttcgtcccattgctggcgggcgacgtcgattgggtcgccctggcccgagctgcggaggcg
gccggctttgacggctgctggatcgccgagcagttcccgaccgagcggcacggggagtcg
gtcctcgacctgacctcggcggcgatggaccggatcctcgggcgtctcgagccggacgga
gtgaatcccaaatga

DBGET integrated database retrieval system