KEGG   Singulisphaera acidiphila: Sinac_5179Help
Entry
Sinac_5179        CDS       T02393                                 

Definition
(GenBank) metal-dependent hydrolase, beta-lactamase superfamily I
  KO
K06167  phosphoribosyl 1,2-cyclic phosphate phosphodiesterase [EC:3.1.4.55]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00440  Phosphonate and phosphinate metabolism
saci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Sinac_5179
Enzymes [BR:saci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.55  phosphoribosyl 1,2-cyclic phosphate phosphodiesterase
     Sinac_5179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B
Motif
Other DBs
NCBI-ProteinID: AGA29331
UniProt: L0DKZ4
LinkDB All DBs
Position
complement(6473320..6474117)
Genome map
AA seq 265 aa AA seqDB search
MEQLVTAPRRLVFLGSGTSTGVPVFGCECAVCTSNDPRNQRTRPSVLLSFPLGNLLIDTT
PEMRLQLLREKIRKVDAIAYTHNHADHLFGLDDARLFPKYLGGPVPVYCEAETEASIRTV
FHYAFVEKATTLPPGYVPKLQFERVAPGVPFQVLGQNVLPLRLEHGRFQVLGFRIGNLAY
CTDVSRIPDESWPLLEGLDTLILDALRHEPHPTHFCLEQALGVVERLRPGRTFLTHLSHG
FDHGPTETTLPPKVALAYDGLTLEF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtggagcaattggtgacggcccctcgacggcttgtgtttctcggcagcggcacatcgaca
ggcgtaccggtctttggctgcgagtgcgcggtctgcacatcgaatgacccccgcaatcaa
cggacgcgccccagcgtcctgctctcattcccgctcgggaacctcttgatcgacaccact
ccggagatgcgtctccaactgctccgcgagaaaattcgcaaagtggatgcgatcgcgtac
acacacaatcacgccgatcatctcttcgggctcgacgacgcccggctcttcccgaagtat
ctgggaggaccggtaccggtctactgcgaggccgagaccgaggcgagcattcgcacggtc
ttccactatgcgttcgtcgagaaggccacgacgttaccgcctggttacgtccccaagctc
cagttcgagcgggtcgcgcccggggtcccgtttcaggtcttgggccaaaacgtgttgccc
ctccggctcgagcacggccggttccaggttcttgggttccggatcggcaacttggcctat
tgcaccgacgtgagccggatccccgacgaaagctggccgttgctcgaagggctcgacacc
ttgatcctcgatgccctaagacacgagccgcacccgacgcacttctgtctcgagcaagcg
ctgggcgtcgtcgagcgtctgcgaccgggacggaccttcttgactcacctctcgcacggc
ttcgaccacggaccaaccgagacgaccttgccccccaaagtcgctttggcctacgatggg
ctgactttggagttctga

DBGET integrated database retrieval system