KEGG   Singulisphaera acidiphila: Sinac_5856Help
Entry
Sinac_5856        CDS       T02393                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00500  Starch and sucrose metabolism
saci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sinac_5856
Enzymes [BR:saci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Sinac_5856
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Sinac_5856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH GHL6
Motif
Other DBs
NCBI-ProteinID: AGA29977
UniProt: L0DL59
LinkDB All DBs
Position
7343656..7346973
Genome map
AA seq 1105 aa AA seqDB search
MAESDPLWYKDAIIYELHVKAFFDSNENGLGDFPGLMQKLDYLQDLGITCLWLLPFYPSP
LRDDGYDIADYFSVHPEYGTVKDFRQLVREAHRRGIRVVTELVINHTSDQHPWFQEARLA
PPGSAKRNFYVWSDSPKKYEAARIIFTDTETSNWTWDPVAQAYYWHRFFHHQPDLNFDNP
QVLRAVFKVMRFWLDMGVDGMRLDAIPYLIEREGTNCENLPESHEILKKFRKEMDEHYSD
RMLLAEANQWPADVLDYFGDGDECHMAFHFPLMPRIFMALRQEDRHPIVEIMRQTPDIPP
DCQWVTFLRNHDELTLEMVTDEERDYMYREYAADPRMRLNLGIRRRLAPLMGNNRRSIEL
MNSLLFSLVGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWTGDRNAGFSRADFARLYAPP
IIDPVFGYQSINVEAQQREASSLLNWMKRLILLRKRFQAFGRGTLEFLHPRNRQVLAYIR
SYGDEKILAVANVSRFVQPFSLDLEQFQGYTPVELFGGVEFPTIGELPYFLSLGPYAFMW
FRLDRLTHSIDSGVARAPALPTEELPNLTLVGGWDTLMEGKSRATLERTVLPNYLLRQRW
FGAKSRTLETVSIRDWVTLTGGTSPALLVFIRAYYSDGHSDRYSLPLAIAEGVAAESLLL
SQPATVLAFVTAGDSAGVIYDAVANDEFCERLLQTIEGPSAIKTRSGMIQGIRTSVYDQI
EGEPTPIQRGSAEQSNSTIFYGRRFLMKLFRRLDIGVNPDLEIGRFLTEKAAFPRIPKTA
GALEYRKSRSEPITIALLQEYVSNQGQGWQLALDVLGRYYEHVSTQEHRLFKIEIESRSL
IELGSMEPPPEVFEVVGAALNTAGVLGKRTAEMHLALASDSEDPSFAPEPIKQEELAEMV
KSLHVQVRRSLTLLREKLASLPDPLRPLAQEILDTGAGMASRFKPLEEGVGPLLKIRCHG
DYHLGQVLWHENDFIILDFEGEPGRPVTERREKKSPLRDVAGMLRSLDYAVYSKLISVSH
DQPENFDRLEPWAKVWKNWTSAAYLREYRATAASLLPNDESVISLLLEFFMLEKTLFEFQ
YELNYRPDWVRIPMLGILHLMKPSH
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtctgacccgctctggtacaaagatgcgatcatctatgaacttcatgtgaag
gccttcttcgacagcaacgagaacggcctgggcgactttcccggcctgatgcagaagctc
gactacttgcaggaccttgggattacctgcctctggctccttcctttctatccttctccg
ctgcgtgacgacggatacgatatcgccgactacttcagcgtccaccctgaatacggcacg
gtgaaggactttcgccagttggtccgcgaagcgcaccggcgagggatccgcgtcgtcacc
gagttggtgatcaatcacacctccgaccagcacccctggttccaggaggcgaggctggct
ccgcctggttcggcgaagcggaacttctatgtctggagcgacagcccgaagaaatacgag
gccgcccgaatcattttcaccgatacggagacttcgaactggacctgggacccggtggcc
caggcgtactactggcatcggttcttccaccaccagcccgacctcaacttcgacaatccc
caagttctccgcgccgtgttcaaggtcatgcggttctggctcgatatgggggtcgacggc
atgcggttggatgccattccctatctcatcgagcgcgaagggacgaactgcgaaaacctg
cccgagagccacgagattctcaagaagttccgcaaggagatggacgagcactacagcgac
cgaatgctgttggccgaggccaatcaatggcccgccgacgtgctcgactacttcggcgat
ggcgatgaatgccacatggcattccactttcccctgatgccacgcattttcatggcactt
cggcaagaagatcgccatccgatcgtggaaatcatgcgccaaacaccggatattcccccg
gattgccaatgggtcacctttctccggaaccatgacgagctgacactcgaaatggtcacc
gacgaagaacgtgactatatgtacagggaatatgcggccgacccgcggatgcgactcaac
ttgggaatccgccgccgcctggctcccttgatgggaaacaacaggcgcagcattgaactg
atgaatagcctgctcttctccctggtcggcacgcccgtcatctactacggcgacgagatc
ggcatgggggacaacatctatctgggagatcgcgacggcgtcaggactccgatgcagtgg
accggcgaccggaacgcgggcttctcgagggccgacttcgcccggctctacgcgccaccg
atcatcgaccctgtctttggctaccagagcattaacgtggaggcccagcaacgcgaggcc
tcctcgctcctcaactggatgaagcgcctgatcttgctcaggaagcgattccaggccttc
gggcggggaactctcgaattcctccacccccggaatcgccaggtcctggcatacatcaga
agctacggggatgagaagattctcgccgtggccaacgtctctcggttcgtccagccgttc
tcgctcgacctggagcaattccagggctatacccccgtggagctctttggtggggtcgag
tttccgacgatcggcgagttaccctatttcctctcactcggcccttacgccttcatgtgg
tttcggctcgaccgattgacccattccatcgacagcggcgtcgctcgggcgcctgcgttg
cccaccgaggaactgcccaacctcaccctcgtggggggatgggacaccctgatggagggc
aagtcgcgggccaccctcgagcgaaccgtcctgcccaactatcttttgcgccagcgctgg
ttcggagcgaaatcgcggactcttgaaacagtgagcatccgcgattgggtgaccttgacc
ggaggaacgtcccctgctctgctcgtcttcatccgcgcctactacagtgacgggcattcg
gatcggtattccctccctctggccatcgccgagggggtcgcggccgagtcgcttttgctg
agccaacccgccacagtcttggcattcgtcacggcaggagactcggcgggggtcatctat
gacgcggttgcgaacgacgaattctgtgaacgcctgctccagacgatcgaggggccgagt
gcgatcaagacccggtcgggaatgatccaggggatcaggacctcggtctacgaccagatc
gaaggagagcccacgccgatccaacgaggctcggccgaacaaagcaattccacgattttc
tatggcagacgcttcttaatgaaactcttccggagactcgacatcggggtgaaccctgac
ctggaaatcggccgttttctcacggaaaaggccgcattcccgagaatcccgaagacggcc
ggggcgttggagtatcgcaagagtcgttccgaaccgatcacaatcgccctcttgcaggag
tatgtttccaaccagggtcaggggtggcaactggctctcgacgtcctcggacgctattac
gagcacgtcagcacgcaggaacaccggcttttcaagatcgagatcgagagtcggtccttg
atcgagctcggttccatggagccgcccccggaggtcttcgaggtcgtcggcgcggccctg
aacacggcgggagtgctcggtaaacggaccgccgaaatgcacctggcattggccagcgat
tccgaggatccaagctttgcgccggaaccgatcaagcaggaggagcttgccgagatggtc
aagtcccttcacgtacaggttcgcaggtcgctcaccttgcttcgcgagaagctcgcatcg
ctcccggatcctcttcggcccctggcgcaagagatcctcgacacgggggccggcatggcc
tcgcgattcaagccgctggaagagggggtcggtcccctcctcaagatccgttgccacggc
gattatcatctcggccaggtactctggcatgaaaacgactttattattctcgacttcgag
ggagagcccggccgccctgtcaccgaacggagagagaagaagtcccccttgcgagacgtg
gccgggatgctccgttcgctcgactacgccgtctacagcaagttgattagcgtcagtcac
gaccagccggagaatttcgatcggctcgaaccctgggccaaggtctggaagaactggacg
tccgccgcttacctgcgcgagtaccgcgcgacggccgcttccttactgcccaacgatgaa
tccgtgatttcgcttctgctggagttctttatgctggagaagacgctcttcgaattccag
tatgaactcaactatcgtcccgactgggttcggattcccatgttgggcatcctccacctg
atgaagcccagccattga

DBGET integrated database retrieval system