KEGG   Singulisphaera acidiphila: Sinac_6203Help
Entry
Sinac_6203        CDS       T02393                                 

Definition
(GenBank) ATP-grasp enzyme, D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00473  D-Alanine metabolism
saci00550  Peptidoglycan biosynthesis
saci01100  Metabolic pathways
saci01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:saci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sinac_6203
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sinac_6203
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Sinac_6203
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saci01011]
    Sinac_6203
Enzymes [BR:saci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sinac_6203
Peptidoglycan biosynthesis and degradation proteins [BR:saci01011]
 Precursor biosynthesis
  Amino acid ligase
   Sinac_6203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AGA30301
UniProt: L0DNN4
LinkDB All DBs
Position
complement(7787817..7788857)
Genome map
AA seq 346 aa AA seqDB search
MRIGIAFDLVPVVASADGPDDRYEEFDKPQTIEALAEVLRADGHDVVLLGDGRALLHRVL
ADPPDFVWNLAEGEGTGRNREARVPAVLEMLGIPYSGSDPLTLAAALDKGVAKRLVADSV
AVPQGVACAAGLSSTQVKSLLRTSKVTEGSHQWIVKPCFEGSSKGIRARCLADTHDEVIE
LYQVLSRDYGQPVLIEEFIAGEEVTVGIVGNGDGAEVIGAMKIRPKTPNDRFVYSIEVKR
DWDDRVEYQTPAQLAPSVMTSLIRSALGSYEALGCRDLARIDFRIRDGVPYFIEANPLPG
LAPDWSDLIILARGMGIGYADLIRKVLRVALTRAGLASASSAGVSS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttgaggatcggaatcgccttcgacctcgtgccggttgtcgcctcggctgacgggcccgac
gaccggtacgaggagttcgacaagccgcaaacgatcgaggccctggctgaggtgcttcgg
gctgatgggcacgacgtcgtcctgctgggcgacggtcgtgcgttgctccatcgcgttctc
gccgatcctcccgacttcgtctggaacctcgccgagggggaagggacggggcggaaccga
gaggctcgtgtcccggccgtgctcgagatgctcggaatcccttattcggggtccgaccca
ctgacgcttgccgctgcgctcgacaagggagtcgccaagcggctggtcgccgattcggtc
gccgtaccccaaggggttgcctgcgccgccggcctttcatcaactcaagtgaagtccttg
ttgcgcacctcgaaagtcactgaaggatcccatcaatggatcgttaaaccctgtttcgaa
ggctcgagcaaaggaatccgcgcgcgttgtctcgctgatacccatgacgaagttatcgaa
ctttaccaggttctctcacgcgattatggccagcctgtcttgatcgaggagtttatcgcg
ggggaggaagtgacggtcgggatcgtcggcaacggggacggtgccgaggtgatcggggcg
atgaagattcggccgaagacgcccaacgatcgcttcgtctactcgatcgaggtgaaacgc
gactgggatgatcgcgtcgagtatcagacgccggctcagcttgctcccagcgttatgacg
agtctgattcggtcggccctcggctcttacgaagccctgggctgtcgcgacctggcgcgg
atcgattttcggatccgcgatggcgtcccttacttcattgaagccaacccgctccctggt
ctggctcccgattggagcgacctgatcatccttgcccgggggatgggaatcggctatgcc
gacttgatccgcaaggttctccgcgtggctttgacccgtgccgggttggcgtcggcttca
agtgcgggagtgagttcgtga

DBGET integrated database retrieval system