KEGG   Singulisphaera acidiphila: Sinac_7054Help
Entry
Sinac_7054        CDS       T02393                                 

Definition
(GenBank) amino acid adenylation enzyme/thioester reductase family protein
Organism
saci  Singulisphaera acidiphila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding ketoacyl-synt Acyl_transf_1 PP-binding KR Ketoacyl-synt_C AMP-binding_C KAsynt_C_assoc adh_short Thiolase_N adh_short_C2
Motif
Other DBs
NCBI-ProteinID: AGA31109
UniProt: L0DP05
LinkDB All DBs
Position
8921553..8936087
Genome map
AA seq 4844 aa AA seqDB search
MKTQHPTESIDDPSSFLDVLRWRALRQPEQTAFVFNGDGDKADLSLTYGELDRRARTLGG
LLQERFPRGERALLVYPPGLEFLAAFFGCLYAGVVAVPVYPPRPNRPMPRLKAIVADCTP
GAVLTTESLRSEAPRWFAQVPELQQPQWLATDLGLDSDDRLADAWRDPGAGPATLAFLQY
TSGSTAAAKGVMVSHGNLVRNSDLIGGCFASTEASRGVFWLPLHHDMGLIGGVLQTLHCG
GTSTLMSPVAFLQRPFRWLQAISETRATISGGPNFAYDLCVRKVTDEQRASLDLSRWTVA
FNGAEPVRAETLERFAEAFAPCGFRREAFLPCYGLAESTLLVSGGPAETRPVVVSLATAP
LEQNQIVPAPTDKPGSRALVSSGRIPAGQVVAIVDPETCRRCAPDRVGEIWVSGPSVASG
YWNQPEITKATFHATLADTGEGPFLRTGDLGFVNNGELIVTGRLKDLIIVRGRNVYPQDV
ERTVEQSHPALRPEGGAAFSVEIDGDEQLVVIHEVERQVKGNDVAEILLAIRRAVAEQHD
LDVHAICLIKAGSLPKTSSGKVQRHASRALYLAGTLEVVGPQVKEPETAGSNVAPSKADR
EHPRATEIEAWLIARVAATLGIQAKQIDTQTPFAGYGLSSLQAVGLAGELQDWLGQPLSP
TLVYEYPTIGELAGHLAGAAHNPVAEPGDRPAEAEPIAIIGVGCRFPGADGPESFWRLLH
DGVDAIGAVPVDRWETAASNGSGKGVPPWGGFLDQVDRFDADFFGISPREAVRTDPQQRL
LLELAWEALEDAGQAVGRLAGTRTGVYVGISTNDYGRLQWDRADSVDPYIVTGNAASIAA
NRLSYLLDFRGPSLAIDTACSSSLVAVHLACQSLRNGEATLALAGGVNVLLSREIGANFA
EAGFLAPDGRCKAFDSRADGYVRAEGAGFVVLKPLSRALADGDPIRALIRGGAVNQDGRS
NGLTAPSRQAQEAVLRDAYRTAGVAPGQVQYVEAHGTGTALGDPIEARALGNVLAEGRPA
DRPCLIGTVKSNIGHLEAAAGIAGLIKTVLTLQHRVIPPSLHFENPSPHIPFAELGIEVQ
GTLRAWPTTEGPALAGVSAFGFGGTNAHLVLEAAPSPSPAPALGDDDDSVLLPLSARSPE
ALRALATSYRDMLASSLDEISLQDIAQTASVRRNHHEHRRAVVARSLGEAAAQLTSEASE
ERLGTGQASKLVLVCSGQGAKWRGAGRLLFEREPVFRAALEQCEACFKPLAGWSLLAQFL
ADEPTDPSAETEVAQPVTLALQVALAALWRSWGIVPDAIVGHSLGEIAAAHLAGAFDLED
AFRIAYHRGRLMRRVAGFGLTAALGLAPHDAQRLVDDSAGRLSLVALNGPEFTTVSGDPN
TVRELVDRLKRQDVFARILDVDCAFHSPQMDPLLGEFAESLAGLQPRATTIPLVSTVTGK
PIAGEALDAAYWGRNLRQTVLFAPAIETLLVIENCPTLFLELGAHPVLGASITRILRQQG
RPGISLPSLKRGEDERGVILRSLGTLYTHGFNVDWPAVAPAGRCAPLPAYPWQRERFWLE
PAAKLPSRNGHSGPKNGKPLEPSIAEWLYELDWIAKEPTARPEVDSSEGPWLILEDSRGV
GQALRAHLEARGIPCELVPCVDVDLEGLLKTKAYHGIVHLGSLDTEVSANPSLAALDDAE
RKGVGSVLPLIQALGNLEPQRDKPKPKLWLVTRGAQPTTSPKPVYLNGNGVHKPKQANDQ
GLAQTPLWGMGRSIALEYAECWGGLIDLDPEAVDGGAAALAAELLDGDGEDQVALRSQGR
YVPRLVRRKAPAPHHGAPLVRPEGTYLITGGLGELGLQAARWLAERGARRLVLVSRRPLP
LRTQWERLTPGDIARKGVAAIQDLERLGATVVVANADVADPEAMAALFERLQATLPPIVG
ILHTAGFITNESTRDLDRQTLAAVLRPKVAGTLVLDALSRDLPLDFFGLFSSVASILGAK
EAHYAAANAFLDAFAHVSKAQGRPVLSVNWGPWAGAGMAASPDRMRAFHLLGFKPLEPDR
AFRVLEGLIHEGRAQALVADVDWSGLKRLHAEEGNRHLLEKIEETRRPQRDLRPSGRREL
ADWRNAPLEQRRETLVRYFRDRVAGVLRLEPDRIDPARPLNTLGLDSLMAIELKGGVEAD
LGTILPLTSLMTGPTITELADQAIALERAPAPSSASLASREPVFEHPLSFGQQSLWHLHR
LDPTSTAYNIAGAARVPIEVDVAVLRRSLQRLVDRHAALRTTFAEVNGRPVQRIHEAATV
SFLVEDVSAWDEAAIHQRLIEEADRPFDLETGPLFRTALFSRSPREHYLLLAVHHIVSDF
WAVAVLLHELGLIVPAERAGVPVQLTPLAIQYTDYVRWQAEMLAGTEGERLWTYWRDQLA
GPLPTLALPTDRPRPAVQSQNGAARTIHLDRTLIQRLTRLGQEHGASLYVTLLAAFQALL
ARQSGQDDLIVGSPVAGRDHQGQTQVVGHFVNPLPLRADLSGNPTFAELLGRARRTVHDG
LEHQDYPFTLLVERLQPTRDLSRSPLFQVLFTFQKAQRLEKEGLTPFALREQGPRLDLGG
FPLESVALEQHAAQFDLAMTTAETEEGLAASIEYNTDLFDRETVDRMLERFRILLEGIAD
APETHLADLPLLTVEERQRVLVAWNDTAAERPTVSFIHHLFEAQAKSAPDANAVIDAHGR
SLSYGELEAKANRLAHHLVAQGVSADSRVGLCVDGSPEMVVGILGILKAGAAYLPLDPDY
PRDRLATMVDDAQVALILSVERLLSILPGDLIRGRVILLDSLEEASSHYPSSPPVVDLHP
DNLAYVIYTSGSTGKPKGVPVSHRNLVHSTESRFLHYRQPVRGFLLLSSFAFDSSVAGIF
WTLSQGGTLVLPSRGSQADPAAIADLVQRQQASHLLCVPSLLNLILDEAPHASLLSLNTV
IVAGEFCPRDLPDRLWARLPEADLFNEYGPTEATVWCTVHRCDQTEVGTIPIGRPIANTQ
AYLLDAQLQPVPIGVAGELYIGGDGIARGYLNRPALTAERFLPDPFGKPGARIYRTGDLA
RWRADGTLEYLGRIDHQVKIRGHRIELGEVEDALNAHPHVQAAVAMARPDAQGNAQLVAY
LVTDDDAQTTTTTAELRRWLKNALPEPMIPSAFVLLDALPLTPNGKVDRNALPNPKANNL
ASGEPYEAPRTQAETLVAQTWELVLKRERVGIHDDFFELGGHSLLATQVVSRLRDAFDTD
IPLRTLFEATTVAALAQRLDELQQGARGVHASSIVAGPSEGPIPASFAQQRLWFLDQLEP
GSPLYNIPLAIQIDGPLDSIALHQALDEIVRRHQALRTTFRAQDGRPIQVFEPVVALPLT
QIDLSSWPLDRRQAEVAQRIDAEAKRPFDLTHGPLIHADLLRLEPTRHVLLLTMHHIISD
GWSLGVLIQEAGALYDAFAHGRPSPLPALPIQYADYALWQRQWLQGQNLNSPLDYWTQQL
AGVTPLEIPTDRPRPPALSYRGGERSTVLAMSLLDELRNLGRQEGATLFMTLTAAFQTLL
HRVSGQNDITVGSPVAGRTRPETEGLIGFFLNTLVLRAELSGELSFRQLLRQTKPVVLDA
FAHQDLPFEQIVEAVSAERDPSRSPLFQAMLILQNAPLPPLATAGLTMTVLEPPINTAKF
DLTLKLTETDQGLHTALEYSTDLFDASTVDRMLGWFETLLEGITANPEAPLADLPLLSRG
ERNWLLDACNDTGIQVPDGSSVPRLFEAQARRTPDATAVIDADGSTLTYAQLDHAANQLA
HHLRSLSAGPNTLVALCTDRSPDMLVTLLAVLKAGAAYLPLDPEYPRDRLEFMLRDSGAA
ILLTQRNLKKLLPDTGARTILLDDDRAVIERQDGTHPPDVTAHSASLAYVIYTSGSTGKP
KGVMIPHDALTNFILAMRALLGLEAGDSLLAVTTLSFDIAVLELFVPLIVGARIQLASRD
EASDGQRLAKRLHDADARFLQATPATWRLLLDSGWQGKPGLAILCGGEAMTRELAERLIP
KADALWNLYGPTETTVWSAAAKVETGNGSVSIGRPIANTQIYILDARLQPLPIGVAGELY
IGGDGIARGYLNRPALTAERFLPDPFGKPGARIYRTGDLARWRADGTLECLGRIDHQVKI
RGHRIELGEVEDALNAHPHVQAAVAVARPDAQGNAQLVAYLVTDDDAQTTTAELRRWLKN
ALPEPMIPSAFVLLDALPLTPNGKVDRNALPNPDTQLIASGVPYEAPRNQAEALVTQAWE
QILKRERVSIHDNFFELGGHSLLATQVVSRLRDAFDTDIPLRTLFEATTVATLAQRLDEL
QQASRGTSAPPLRPAPRDQGPLPASFAQQRLWFLDQLEPGSPLYNIPLAIQIDGPLDSIA
LQSALDEVVRRHESLRTHFLAKDGRPIPVFAPDLTVALPTTDLSTWPLDRRQAEVANRME
VEARRPFDLAHGPLIHAALLSLDQGQHILLLTLHHVIADGWSLGVLVREAGALYDAFAQG
RPSPLPPLPIQYADYALWQRQWLQGQNLNDQLAYWTQQLAGVTPLEIPTDRPRPPALTHQ
GGERSTTLALPLVDDLRKIARQEGATLFMTLVAAFQTLLHRVSGQNDITIGSPVAGRTRS
ETEGLIGFFLNTLVLRAELSGELSFRQLLRQTKPVVLDAFAHQDLPFEQIVEAVSAERDP
SRSPLFQAMLILQNAPLPPLATAGLTMTVLEPATATAKFDLTLKLTETDQGLHAALEYAT
DLFESTTVDRMLGWFRTLLEGIVANPEIPLADLPLLTDDERQRVLVEWNAEREKAPSPSS
LPPLVQPQPIHHGNGILDHGHDLDGLSDDEVESLLQSLLVDDES
NT seq 14535 nt NT seq  +upstreamnt  +downstreamnt
atgaagacacaacaccccaccgaatccatcgacgatccctccagcttcctcgatgtcctc
cgatggagagctctgcgtcagcccgaacaaacggccttcgtcttcaacggagacggcgac
aaggcggatctctccctgacatatggggaactggaccggcgagcgcgaaccctgggggga
ctcctccaggaacggttccctcgcggtgaacgtgcgctgctggtttatccgccgggcttg
gagttcctcgccgccttcttcggctgcctctatgccggtgtggtggccgttcccgtctac
ccgccgcgtcccaatcggccgatgccccggctcaaggcgatcgtggctgactgcaccccc
ggggccgtcttgacaaccgagagcctgcgcagcgaggccccccgctggttcgcccaggtt
cccgagttgcaacagccccagtggctcgccaccgaccttggcctcgacagcgacgaccgc
ctggccgacgcctggcgcgacccgggtgccggcccagcaacgttggctttcttgcagtac
acctccggctccacggcggcggccaagggggtaatggtcagccacggcaacctggtccgg
aactcggacctgatcggcggctgcttcgcctcgaccgaagcgagtcgaggagtcttctgg
ctcccgctccatcacgacatggggttgatcggcggcgtcttgcaaacgctccactgcggg
gggaccagcacgctgatgtcgccggtcgccttcctccaacgtccgttccgctggctgcaa
gccatctcggaaacccgggcgaccatcagcggaggccccaacttcgcctacgacctctgc
gtccgcaaggtgaccgacgagcagcgggccagcctcgacctgagccgctggaccgtcgcc
ttcaacggcgcggagccggtccgggccgaaacgctcgaacgcttcgccgaagcgtttgcc
ccttgcggcttccgccgcgaggcctttctcccctgctacggccttgccgagtcaaccttg
ctcgtctcggggggacccgccgagacccggccggtcgtcgtctcgctggcgacggcccct
ctggagcagaaccagatcgtcccggccccgaccgacaagccgggctcccgcgccctggtc
agctcgggccgaatccccgccgggcaggtcgtcgccatcgtcgatcccgagacctgccgc
cgttgcgcccccgaccgggtcggcgaaatctgggtctcgggcccgagcgtcgcctcggga
tactggaatcaacccgagatcaccaaggcaacctttcacgcaaccctggccgacaccgga
gaggggccgttcctccggaccggcgacctcgggttcgtcaacaacggcgaattgatcgtc
accggtcgcctcaaggacctgatcatcgtccggggacggaacgtttacccacaagacgtc
gagcggaccgtcgaacagagccaccccgcgctccggcccgaagggggcgcggcgttctcc
gtggagattgacggtgacgagcaactcgtcgtcatccacgaggtcgagcggcaagtcaaa
gggaacgacgtcgccgaaatcctcctggcaatccgccgcgccgtcgccgagcagcacgac
cttgacgttcacgccatctgcctgatcaaggcagggagcctccccaaaacctccagcggc
aaagtccagcgccacgccagccgcgcgctctatctcgcggggacgctcgaggtggtcggc
ccccaggtcaaggagcctgagaccgccggatcaaacgtagcgccctccaaggcggatcgc
gaacacccaagggcaaccgagattgaggcctggttgatcgccagggtggccgccaccctg
ggaattcaggcgaagcagatcgacacccaaacccccttcgctggctacggactcagctcg
ctccaggcggtggggctggcgggcgaacttcaagactggctcgggcagcccctctcgccg
acgctcgtttatgagtatccgacgatcggggaactcgccggtcacctggccggcgccgcg
cacaacccagtggccgagcctggcgacaggcccgccgaggccgaaccgatcgcgatcatc
ggggtcggctgccgcttcccgggggccgatggacctgagtccttctggcggctcttgcac
gacggggtcgacgccatcggcgcagtgcccgtggatcgctgggagaccgccgcgagcaac
gggtcgggcaagggagttcccccttgggggggcttcctcgatcaggtcgatcggttcgac
gccgacttcttcgggatctcgccgcgcgaagcggtccggaccgacccgcaacagcgtctg
ctcctggaactcgcctgggaggcgctcgaggatgccggccaggcggtcggccgattggca
gggacgcgcaccggcgtctacgtcgggatctcgaccaatgactacggccggctccaatgg
gatcgagccgactcggttgacccttatatcgtgacgggcaacgccgcgagcatcgcggcc
aatcgcctatcatacttgctcgactttcgaggcccgagcctggcgatcgacacggcctgc
tcatcgtcactggtggcggtccatctcgcctgccagagccttcgaaacggtgaggcgaca
ctcgccctcgctggcggggtgaacgtcctgctctcccgcgagatcggggcgaatttcgcc
gaggcggggttcctcgcccccgacggccgctgcaaagcgttcgactcccgcgcggacggg
tacgtccgggccgagggggccggtttcgtcgtcctcaagccgctctcccgcgctctggcc
gacggcgacccgatccgcgccttgatccgagggggggcggtcaaccaggacggccgctcc
aacggcctgacggcaccgagccgccaggcgcaagaggccgtcctccgcgacgcctatcgc
acagcaggggtggcccccgggcaagtccagtacgtcgaggcccacggcacggggacagcg
ctcggcgacccgatcgaggcgcgggcgctcggcaacgtgctggcagagggccggcccgcg
gatcgaccatgcctgatcggcacggtcaaatcgaacatcggccacctagaagcggccgcc
gggatcgctggcctgatcaagacggtgctcacgctccagcaccgagtgattccgcccagc
ctgcactttgaaaacccaagtccgcatatcccttttgccgagctggggatcgaagtccaa
ggcacgctcagggcctggccaaccaccgaagggccggccctcgccggagtcagcgccttc
ggatttggcggaaccaatgcccacctcgttctggaggcggctccgagtccaagcccggct
cccgcacttggcgacgatgacgattcggtgctgctgccgctctccgctcgcagtcccgag
gcgctgcgggcgttggcaacatcgtatcgtgacatgctggcgtcatcactcgacgaaatc
tcgctccaagacatcgcccagaccgcgagcgtccgccgcaaccatcacgagcatcgccgg
gccgtcgtggctcgatcactcggtgaggccgccgctcaactcacctcggaggcttctgaa
gaacgactcggcacgggacaggcctcgaaactcgtcctcgtctgctccggccaaggagca
aagtggcgaggagcgggacgcctgctctttgagcgcgaacccgtcttccgggccgctttg
gaacagtgcgaggcctgcttcaaaccgcttgccggctggtcgctcttggctcagttcctg
gccgacgagccgaccgacccgagtgccgagaccgaggtggctcagccggtgaccctggcc
ctgcaagtcgccctcgccgcgctctggcggtcgtgggggatcgtgcccgacgcgatcgtc
ggccacagcctcggcgagatcgccgcagcccacctcgccggggccttcgatctcgaggac
gcgttccgaatcgcctatcatcgcggccgcctgatgcgtcgggtggccgggttcgggctc
acggccgccctcggccttgctccccacgacgcccagcgcctcgtggatgactcggccggc
cggctctcgcttgtcgccctgaacgggccggagttcaccaccgtctcgggtgatccgaac
accgtccgcgaactcgtcgaccggctcaaacgtcaggacgtgtttgcccgtatcctcgac
gtcgactgcgcgttccatagcccgcaaatggatcctttgctcggcgagttcgccgagtcc
ctggccgggctccagcctcgagcgaccacgatccccctcgtctcgacggtcaccggaaaa
ccgatcgcgggcgaagcgctcgacgccgcctactggggccgcaacctccggcagaccgtc
ctcttcgcgccggcgatcgaaacgctactggtcatcgagaattgcccgactctgttcctg
gaactcggcgcccacccggtgctcggcgcgtcgatcacccggatcctccgccagcaaggg
cggccggggatcagccttccttccctaaagcgcggcgaggacgaacgcggggttatcctc
cgctcgctgggcacgctctacacccacggcttcaacgtcgactggccggccgtcgccccc
gccgggcgttgcgccccgctccctgcctatccctggcagcgcgagcggttctggctcgag
cccgcagccaagctcccttcgcggaacgggcattccggtcccaagaacggcaagccgctc
gaacccagcatcgccgagtggctctatgaattggactggatcgcgaaagaaccgacagcc
cggccagaggtcgacagttccgaaggcccttggctcatcctcgaagattcccgaggcgtg
ggccaggccctccgagcgcatctggaagcgcggggcatcccgtgtgagctcgtcccctgc
gtggacgtcgacctcgaaggactccttaaaacaaaggcctatcacggcatcgtccacctg
ggaagcctggacacggaggtctcggccaaccccagtctcgccgccctcgacgacgcggag
cggaagggcgtcggcagcgtgctaccgctaatccaggccctcgggaacctggagccgcaa
agggacaaacccaagccaaagctctggttggtaacccgaggggcacaaccgaccacaagc
ccgaagcccgtttacctgaatgggaacggggttcacaagccgaagcaagcaaacgatcaa
ggccttgcacaaacgcctctttggggaatgggccgatccattgcgctggagtacgcggag
tgctggggcggcctgatcgaccttgaccccgaagccgtcgacggaggagccgccgctctg
gcggccgagctcctcgacggggacggcgaagaccaggtcgccttgcggagccagggacgc
tacgtccctcggctggtccgccgcaaagccccggccccgcatcacggggcgccgctggtg
cggcccgaaggcacgtacctgatcacaggggggctcggagagctcggccttcaagcggct
cgctggctggcggaacgcggagcgcgccggctcgtgctggtgagtcgtcggccacttcct
ttgcgcacgcaatgggagaggctcacccctggagacatcgcccgcaaaggggttgctgcg
atccaggatctcgagcggctgggcgcgacggtggtggtcgccaacgccgacgtggccgac
cctgaagccatggcggcgctgttcgagcggctccaggcaacgctccccccgatcgtgggg
atccttcacacggcggggttcatcacgaacgaatccacccgtgacctcgaccggcaaacc
ctcgccgccgtgctccggcccaaggtcgccggcaccctggtcctcgacgcgctgagccgc
gacctcccgcttgatttcttcggcttgttctcttcggtcgcctcgatcctgggggccaag
gaagcgcactacgccgccgccaacgcgtttctcgacgccttcgcgcacgtctcgaaggcc
caggggcgacccgtcctgagcgtcaactggggaccttgggccggggccggcatggcagcc
tcgcccgatcggatgcgtgccttccacctcctcggcttcaagccgctcgaacccgatcgg
gcgtttcgagtccttgagggcctgatccacgaaggcagggctcaagccctcgtggccgat
gtcgactggtccggcctgaaacggcttcatgcggaggaaggcaaccggcatctcctcgag
aagatcgaggagacccgacgcccccaacgcgacctgcgtccctcaggccgaagggagctg
gcggactggcggaacgcccccctcgagcagcgccgcgaaaccctggtccgctacttccga
gaccgcgtggccggggtgctccggctggaacccgaccggatcgaccccgcgcgtcccttg
aacacgctgggactcgactcgctgatggccatcgagctgaaggggggcgtcgaggccgac
ctcggcacgatcctcccgctcacgagcctcatgacgggtccgaccatcaccgagctcgcc
gaccaggcgatcgccctcgagcgtgcccccgctccctcctccgcgtctctggcttcacgc
gagccggtcttcgagcatccgctgtcgttcggccagcagtccctctggcacctgcatcgc
cttgatcccacgagcacggcctacaacatcgcaggggcggcccgcgtcccgatcgaggtc
gatgtggccgtgctccgccgcagcctccagcgcctcgtcgatcgccacgccgcgctccgg
accaccttcgccgaggtcaatggccgtcccgtccagcggatccacgaggcggcgaccgtc
tcattcttggtcgaggacgtctccgcctgggacgaggccgccatccaccagcggctgatt
gaggaggcggaccgcccgttcgacctggagaccggcccgctcttccggaccgccctgttt
tcgcggtcgccccgggagcactatctcctgctggcggttcatcatatcgtcagcgacttc
tgggcggtcgccgttttgctccacgagctcggcctgatcgtcccggccgaacgagccggt
gttcctgttcagctcacaccgctcgcgatccagtacaccgactatgtgcgctggcaggcc
gagatgctggccggaaccgagggggagcggctctggacctactggcgggaccagctcgcc
ggcccactccccacgctcgctttgccgaccgatcggccccgccccgcagtgcagtcgcag
aatggagcggcgcggacgatccatctcgaccggacgctgattcaacgcctgactcgactg
gggcaggagcacggggcaagcctctacgtcaccttgctggcagccttccaggctttgctg
gcgcgtcagagcggccaggacgacctgattgtcggctcccccgtggcaggccgggaccat
caaggccagacccaggtggtcggccacttcgtcaacccgttgccgctccgggccgacctc
tcgggaaacccgaccttcgccgagctgctcggccgcgcccggcggaccgtccacgacggc
ctcgaacaccaagattacccgttcacgctgctggtggaacggctccagccgacccgcgac
ctcagccgctcgcccctctttcaggtcctgttcaccttccagaaagcgcagcggctcgag
aaggaagggctgaccccgttcgcgctccgagagcaagggccacgcctggacctgggcggc
ttcccccttgagtccgtcgccctcgagcagcacgccgcccagttcgacctggcgatgacc
acggccgaaacggaagagggacttgccgcttcgatcgagtacaacaccgacctgttcgac
cgcgaaaccgtcgaccgcatgctcgagcgattccggatcctcctcgaagggatcgccgac
gcccccgagacgcacctggccgacctcccgctcctgaccgttgaggagcgtcagcgcgtg
ctcgtcgcctggaacgacaccgccgccgagcggcccacggtgtcattcatccatcacctg
ttcgaggcccaggccaagagcgctcccgacgccaatgccgtcatcgacgcccacggtcgc
tcgctctcctacggcgagctcgaggcgaaggcgaaccggctcgcccatcatctcgtcgcg
caaggggtcagcgcagactcccgagtcgggctctgcgtcgacggctcacccgagatggtc
gtcggcatcctcggcatcctcaaggcaggggccgcctaccttcccctcgaccccgactat
ccgcgcgatcgcctggccacgatggtcgacgatgcgcaggtcgctttgatcttgagcgtg
gagcgactgctcagcattttgccgggcgacctgattcgtggccgcgtcatcctgctcgac
agcctcgaggaagcaagttcccactacccgagcagcccgccggtcgtcgacttgcacccc
gacaatctggcttatgtgatctacacgtcgggctccaccggcaagcccaaaggggtgccg
gtctcgcaccggaacctggttcattcaaccgagtcgcgattcctccattaccggcagccg
gtccgcgggttcttgctgctctcctcgttcgccttcgacagttcggtggccgggatcttc
tggaccctcagccaagggggaacgctcgtgctcccctcccgagggtcacaagccgaccca
gccgcgatcgccgacctcgtgcaacggcaacaggcctcccacttgctctgcgtcccctcg
ctcttgaacctgattctcgatgaggctccgcacgcaagcctgctgagcctgaataccgtc
atcgtcgcgggagaattctgcccccgcgacctgcccgaccgactgtgggcacggctcccc
gaggccgacttgttcaacgagtacgggccgaccgaagcgaccgtctggtgtaccgttcat
cgatgcgaccaaaccgaggtcggaaccatcccgatcggccggcccatcgccaacacccaa
gcatatctccttgatgctcaacttcagcccgtccccatcggcgtggccggcgagctctac
atcggcggcgacggcatcgcgcgaggctatctcaaccgacccgcactcaccgccgaacga
ttcctccccgaccccttcggaaagccgggcgctcggatctaccgaaccggcgacctcgct
cgttggcgcgccgacggcaccctcgaatacctcgggcggatcgaccatcaggtcaagatc
cgcggacaccgcatcgagctcggcgaagtcgaagatgccctcaatgcccatccccacgtc
caggccgccgtcgccatggcacgacccgacgctcaagggaatgcccaactcgtcgcctat
ctcgtcaccgacgacgacgctcaaacgacgaccaccaccgccgaactccgccgctggctc
aagaacgccctccccgagccgatgattccctccgcattcgtcctgctcgacgccttgccg
ctcacccctaacggcaaggtcgaccgcaacgcactccccaatcccaaggccaacaacctc
gcctcgggagaaccgtacgaggcgcctcgtacccaggccgaaacccttgtcgcccagacc
tgggaactcgtcctcaagcgggaacgcgtcggcatccacgacgacttcttcgagcttggc
ggccactcgcttctcgccactcaggttgtttcccggctccgcgacgccttcgacaccgac
atccccctccgaaccctcttcgaggcgaccaccgtcgccgcactcgctcaacgcctcgac
gagcttcagcaaggcgctcggggagtccatgcgtcctcgatcgtcgccgggccgtcggaa
gggccgatcccggcctcgttcgcccagcagcggctctggttcctcgatcagcttgagccg
gggagcccgctctacaacatcccgctcgccatccagatcgacgggccgctcgactccatc
gccctccaccaggcactcgatgagatcgtccgccgccaccaagcgctgcgaacgacgttc
cgagcccaggatggacgcccaatccaggtcttcgaaccggtcgtggctctccctctgacc
caaatcgatctctcctcctggccactcgatcgacgccaggccgaggtcgcgcaacggatc
gacgccgaggccaagcgccccttcgacctgactcacggcccgctcatccacgcagacctg
ctccggctcgagcccacgcggcacgtcctgctcctgaccatgcaccacatcatttccgat
ggctggtcgctcggcgtcctcatccaagaggcaggagcactctacgacgcattcgctcac
ggccgaccttcaccgctccccgcactcccgatccagtacgccgattacgccctctggcag
cgccaatggctccaaggtcaaaacctcaacagcccgctcgactactggacccagcagctc
gccggcgtgaccccgctcgagatccccactgaccgccctcgcccccccgccctctcctat
cgaggcggcgagcgttccacggtcctcgcgatgtccctgctcgacgaactccgtaacctc
ggcagacaggaaggggccaccctcttcatgaccctgaccgccgccttccagaccctcctc
catcgcgtgtcaggacagaacgacatcaccgtcggatcacccgtcgcgggacggacccgg
cccgagaccgaagggctcatcggcttcttcctcaataccctggtcctccgcgcggaactc
tcaggagagttgagcttccggcaactcctccgacagaccaagccagtcgtcctcgacgcc
ttcgcgcatcaggacctccccttcgagcaaatcgtcgaggcagtgagcgcagaacgcgac
cccagccggtcccccttgttccaggccatgctcatccttcagaacgcaccgttgccgcca
ctcgcaaccgccgggctgacgatgaccgtcctcgagcctcccatcaatacggccaagttc
gacctcacactcaagctgaccgagaccgatcagggcctccacaccgccctcgagtacagc
accgacctgttcgacgcgagcacggtcgaccggatgctcggatggttcgaaaccttgctg
gaaggcatcaccgccaaccccgaggcgccactggccgacctgccgctcctgagccgggga
gaacgcaactggctcctcgacgcgtgcaacgacaccggcatccaagtgcctgatggatca
tcggtccctcgcttgttcgaggcgcaagccagacgcacgcccgacgccacggccgtgatc
gacgccgacggctctaccctcacctacgcccagctcgaccacgctgccaaccagctcgcg
caccatctccgatcgctgagcgctggacccaacacactcgtcgcgctctgcaccgaccgc
tcacccgacatgctcgtcacgctcctcgccgtcctcaaagcgggcgcggcctacctcccg
ctcgaccccgagtatccacgcgaccggctcgagttcatgctccgcgactctggagccgca
atcctcctcacgcagcgaaacctcaagaaactgctaccggacaccggggcacgcacaatc
ctcctggatgacgaccgcgcggtgatcgaacgccaagacgggactcacccgcccgacgtc
acggcccactccgcaagcctcgcctacgtcatctacacctcgggctccactggaaagccc
aagggcgtcatgatcccacatgacgccctcacaaacttcatcctcgccatgcgggctctc
ctcggactcgaggctggcgactcgctcctcgccgtcaccaccctctccttcgatatcgcc
gtcctcgaactcttcgtaccgctcatcgtcggcgctcgcatccaactcgcttcacgcgac
gaagccagcgacggacaacgactcgccaagcgacttcacgacgccgacgcgcgattcctc
caggccactcccgctacctggaggctcctcctcgactcaggatggcaaggaaaaccggga
ctggccatcctctgcggcggcgaagccatgacgcgggaactcgccgagaggctcatcccc
aaggccgacgcactctggaacctctacgggccgaccgaaaccaccgtctggtccgcagcc
gccaaggtcgaaaccggaaacggatccgtctccatcggacgacccatcgccaatacacag
atctacatcctcgacgccaggctgcaaccactccccatcggcgtggccggcgagctctac
atcggtggcgacggcatcgcgcgaggctatctcaaccgacccgcactcaccgccgaacgg
ttcctccccgaccccttcggaaagccgggcgctcggatctaccgcaccggcgacctcgcc
cgttggcgcgccgacggcaccctcgaatgcctcgggcggatcgaccatcaggtcaagatc
cgcggacaccgcatcgagctcggcgaagtcgaagatgccctcaatgcccatccccacgtc
caggccgccgtcgccgtcgcacgacccgacgctcaagggaatgcccaactcgtcgcctat
ctcgtcaccgacgacgacgctcaaacgacgaccgccgaactccgccgctggctcaagaac
gccctccccgagccgatgattccctccgcgttcgtcctgctcgacgccttgccgctcacc
cctaacggcaaggtcgaccgcaacgcgctccccaatcccgacacacagctcatcgcctcc
ggggtcccctacgaggcgccccgcaaccaggccgaggcccttgtcacgcaagcttgggag
caaatcctcaagcgagagcgggtcagcatccacgacaacttctttgagcttggcggccac
tcactcctcgccacccaggtcgtctcccgactccgcgacgccttcgacaccgacatcccc
ctccgaaccctcttcgaggcgaccaccgtcgccacactcgctcaacgcctcgacgagctc
cagcaagccagccgaggcaccagcgcaccgccgttgcgaccagcgccgcgggatcaaggc
cccctccccgcctcgttcgcccaacagcggctctggttcctcgatcagctcgagccgggg
agcccgctctacaacatcccgctcgccatccagatcgacgggccgctcgactcgatcgcc
ctccaaagcgcactcgacgaggtcgtccgccgccacgaatcgctccggacccacttcctc
gccaaggacggacggccgatcccggtcttcgctccggatctgaccgtcgccctgcccacg
accgacctctccacctggccgctcgaccgccgccaggccgaggtcgcgaaccgaatggaa
gtcgaggcacgaagacccttcgacctcgcacacggacctttgattcatgcggccttgctc
tctctcgaccaaggccagcacatcctcctgctcaccttgcaccacgtcatcgctgacggc
tggtcgctcggtgtcctcgttcgcgaggccggagcactctacgacgcgttcgcccaggga
cgtccttcgcctttacccccgctcccgatccagtacgccgactatgccctctggcagcgt
caatggctccaaggtcaaaacctcaacgatcagcttgcctactggacccagcagcttgcc
ggcgtgaccccgctcgaaatccccaccgaccgaccgcgcccccccgccttgactcatcaa
gggggcgaacgatccacgaccctcgcgctgcccttggtcgacgatctccgcaagatcgcg
cgacaggaaggcgccaccctcttcatgaccttggtcgccgccttccagaccctcctccat
cgcgtctccggacagaacgacatcaccatcggatcgcctgtcgcaggacggacccgctcc
gagaccgaggggctcatcggcttcttcctcaataccctggtcctccgcgcggaactctca
ggagagttgagcttccggcaactcctccgacagaccaagccagtcgtcctcgacgccttc
gcgcatcaggacctccccttcgagcaaatcgtcgaggcggtgagtgcagaacgcgacccc
agccggtcccccttgttccaggccatgctcatcctccagaacgcaccgttgccgccactc
gcaaccgccgggctgacgatgaccgttctcgaaccggcaaccgccaccgccaagttcgac
ctcacactcaagctgaccgagaccgatcagggcctccacgccgccctcgagtacgccacc
gacctgttcgagagcaccaccgtcgaccggatgctcggctggttccgaaccctgctcgaa
gggatcgtcgctaaccccgagatccccctggccgacctgccgctcctgaccgacgacgaa
cgccaacgcgtcctcgtcgagtggaatgccgaacgggagaaagccccgtcgccgtcatcg
ctgcccccccttgtacaacctcagccaatccaccacgggaacggcatactcgatcacgga
catgacctcgacggcctctctgacgacgaggtggaatccttgctccaaagtctgctggtc
gacgacgaaagctga

DBGET integrated database retrieval system