KEGG   Sulfolobus acidocaldarius N8: SacN8_03820Help
Entry
SacN8_03820       CDS       T02452                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sacn  Sulfolobus acidocaldarius N8
Pathway
sacn03030  DNA replication
sacn03410  Base excision repair
sacn03420  Nucleotide excision repair
sacn03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sacn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SacN8_03820
   03410 Base excision repair
    SacN8_03820
   03420 Nucleotide excision repair
    SacN8_03820
   03430 Mismatch repair
    SacN8_03820
Enzymes [BR:sacn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SacN8_03820
    6.5.1.6  DNA ligase (ATP or NAD+)
     SacN8_03820
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SacN8_03820
DNA replication proteins [BR:sacn03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SacN8_03820
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SacN8_03820
DNA repair and recombination proteins [BR:sacn03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SacN8_03820
   NER (nucleotide excision repair)
    Other NER factors
     SacN8_03820
   MMR (mismatch excision repair)
    Other MMR factors
     SacN8_03820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AGE70736
UniProt: M1IU49
LinkDB All DBs
Position
complement(630113..631909)
Genome map
AA seq 598 aa AA seqDB search
MEFKLIAEYFDRLEKISSRIQLTALLTDLLKKSDKDVIDKVIYITQGKLWPDFFEKPEIG
LGEKLMIKALSVSTNIKEDEIEKQLRILGDLGEVAYKLKRTNSSQNVLSYLGSTKVTKLT
VEEVYESLSKIALSEGEGSRDMKIRSLAGLLKKADPLEAKYIIRFIDGRLRVGIGDATIM
DALANVFGGGTAARPLIERAYNLRADLGNIAKLLAENGIETIKSIKPEVGIPIRPMLAER
LTDPSEILAKVGGKGIVDYKYDGERAQIHKKGEKVYIFSRRLENITRQYPDVVEYIKNSI
KSNEVILEGEIVAIDKESGEILPFQNLMHRKRKNDIGEAIKEYPVNVYLFDLMYNDGEDY
TQKPLPDRREKLEEIVTQNDIVKVADHKYIDKVNELVEYFHQAISDGTEGVIVKSIGKDS
IYQAGARGFLWIKLKKDYQSEMADSVDLVIVGAFYGRGKRGGKLSSLLMAAYDPDKDTFY
TVCKVASGFSDAELEEVQKMLSEAKLDKKDPRVESEIQPDIWVKPKYVAEIIGAEITLSP
LHTCCKGVVSEEAGLSIRFPRFIRWRDDKSVEEATTPNEILEMYQSRLKKKVEDITET
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
gtggagtttaaattaattgctgaatattttgacagattggaaaaaatttcatcaagaatt
cagctcacagctctcttaacggatttgttaaagaaatcagataaggatgtaatagataaa
gttatatatattactcaaggtaaattgtggccggacttctttgagaagcctgaaatcggt
cttggagaaaaacttatgattaaagcactctcagtttcaactaacataaaagaagatgaa
attgaaaagcaattacgaattctgggtgacctaggagaggtagcttacaaacttaagaga
actaattcatcacaaaatgtcctatcgtatttaggttccactaaggtaactaagctaact
gtagaagaggtttatgaatcactgagtaagatagcattgtctgagggagaaggaagcaga
gatatgaaaatacgttccctagcagggctcctcaaaaaagctgatccattggaggctaaa
tacataattagattcattgatggtagattgagagttggcataggtgatgccacaatcatg
gacgcgttagcaaatgtatttggtggtggaactgctgcacggccgttgatagaacgtgca
tataatttgagagctgatctcggaaatatagctaaacttttagcagaaaatggcatagag
actataaagtcgattaaaccagaggttgggataccgattagaccaatgcttgctgaaaga
ttgacagacccatcagaaatattagccaaagttggcggtaaaggaatagtagactataag
tatgatggagagagagctcaaatccacaaaaaaggtgagaaagtttatatcttctctaga
cgactagagaatataaccagacagtacccagacgttgttgagtacataaaaaactctatc
aaaagtaatgaagttattcttgaaggagaaatagttgcgatagataaagaaagcggagag
atccttcccttccagaacctaatgcataggaaaagaaagaatgatataggcgaggctata
aaggagtacccggtcaatgtatatctatttgatctcatgtataatgacggtgaagattat
acacaaaaacccttaccagacagaagagaaaaattagaggaaattgtgacacagaacgat
atagttaaggttgcagatcacaaatatattgataaagttaatgagttggtagagtatttc
catcaggcaattagtgatggcacagaaggtgttatagtaaaatctataggtaaagactca
atatatcaagcaggagctaggggatttttgtggataaaattaaagaaagactatcaaagc
gaaatggctgatagcgttgatctggttattgtgggagctttctatggcaggggtaaaagg
ggaggtaaactcagttccttattaatggcagcatatgatcctgataaagatactttctat
actgtgtgtaaagtggcatcaggcttcagtgatgctgaattagaggaagtacaaaagatg
ttatctgaagctaaattagataaaaaagatcctagagtggaatctgaaatacaaccagat
atatgggtaaaaccgaaatatgtagctgaaatcattggtgctgaaataaccttatctcca
ttacatacttgttgcaagggtgttgtctcagaagaagctggtttatccataagatttcca
cgcttcataagatggagggatgacaaaagcgttgaagaagccacaacaccaaatgagata
ttagagatgtatcagagtagactgaaaaagaaagttgaggacataacagagacatag

DBGET integrated database retrieval system