KEGG   Sulfolobus acidocaldarius N8: SacN8_10440Help
Entry
SacN8_10440       CDS       T02452                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K14465  succinate semialdehyde reductase (NADPH) [EC:1.1.1.-]
Organism
sacn  Sulfolobus acidocaldarius N8
Pathway
sacn00720  Carbon fixation pathways in prokaryotes
sacn01100  Metabolic pathways
sacn01120  Microbial metabolism in diverse environments
sacn01200  Carbon metabolism
Module
sacn_M00375  Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sacn00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SacN8_10440
Enzymes [BR:sacn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SacN8_10440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Sacchrp_dh_NADP ThiF
Motif
Other DBs
NCBI-ProteinID: AGE72038
UniProt: M1I7X9
LinkDB All DBs
Position
1925130..1926221
Genome map
AA seq 363 aa AA seqDB search
MLAGVLHNYKEPITVEEVEIEEPKENEVMIEVKATGMCHSDVNVFLGSTPVPTPVIAGHE
IAGRVVKVGHNVSRVKEGDRVISTFIQPCGKCKNCISGMENLCETFASVRLKGTMFDGTT
RVKYKDGRSIRTFLGGGFAEYSIVHENALTRMEDSNVNIEELAVLGCSGITAYGAISSAN
VRPGDSVAVVGVGGVGLSVIQMLRAVGAGRIIALGTKKWKLEKALELGATDFINTKESEP
VKTLKEMTNGGPDIIIEAGGTQETIQMALEGVRIGGKVVLIGLPPTSALIPVRVSMIVRN
GITIIGNYGSKPRVDMPKLVELVRTKRYDPQKLITGKFKLEEINEAVKLLEEGLAIRSLI
IPH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgctagcaggagtgcttcataactataaggaacctataactgtggaggaagtggaaata
gaggagcctaaggaaaatgaggtaatgatcgaggttaaggctactggaatgtgccactct
gatgtaaatgtttttttagggtcaactcccgtccctacgcctgtaatagcaggacatgaa
atagcaggcagagttgtgaaggtggggcataatgtaagtagggtaaaagaaggcgatagg
gttatatcaactttcattcaaccctgcggaaagtgtaagaattgtatatctggtatggaa
aatctttgtgagacttttgcatcggtcagactgaaaggtacaatgtttgacggtacaact
agagttaaatataaggacggaaggtctataaggacatttttaggtggagggtttgcggaa
tattctatagtgcacgaaaatgccttaactagaatggaagacagcaacgtgaatatagag
gaactagctgtgttaggatgttctggtataactgcttatggtgcaattagctctgccaac
gtaagacctggggatagtgtagctgtagtaggagtaggtggtgttgggctatcagttata
caaatgctgagagcagtgggggcagggagaataattgctctaggaacaaagaagtggaaa
ttggaaaaagctctagagcttggggcaacagattttataaacaccaaggaatctgagcca
gtaaaaaccctgaaggaaatgactaatggaggtccagatataataattgaggctggggga
acccaagagactatacaaatggctttagaaggggttagaattggagggaaagtggttttg
ataggcttaccacctacatcagctctcattccagttagagtctcaatgatagtgagaaat
ggaatcactataataggtaattatggcagtaaacctagggtagatatgccgaaactagta
gagttagttaggacaaagagatacgacccacagaaactcattacaggaaaattcaagtta
gaggaaatcaacgaggctgtgaaattgttagaggaggggctcgcaataaggagtttaatt
attcctcactag

DBGET integrated database retrieval system