KEGG   Sulfolobus acidocaldarius SUSAZ: SUSAZ_00275Help
Entry
SUSAZ_00275       CDS       T02975                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sacs  Sulfolobus acidocaldarius SUSAZ
Pathway
sacs00620  Pyruvate metabolism
sacs00680  Methane metabolism
sacs00720  Carbon fixation pathways in prokaryotes
sacs01100  Metabolic pathways
sacs01120  Microbial metabolism in diverse environments
sacs01200  Carbon metabolism
Module
sacs_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sacs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SUSAZ_00275
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SUSAZ_00275
   00680 Methane metabolism
    SUSAZ_00275
Enzymes [BR:sacs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SUSAZ_00275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHC50584
UniProt: V9S6G3
LinkDB All DBs
Position
44320..45855
Genome map
AA seq 511 aa AA seqDB search
MRKIPRTMSTQHPDNAKVPEWNQGEAISGENEIIEAYLAFSRYGVEEVMWDAEGKDVDTH
VVRKLLSQYPEFFRHRILGKDIFLTYRVPNPKIEGAERKVFAETLNTIPITYDLAEKFYG
ENPNPPVFEVILPFTTSYEELIAVIKFYEKVIVNSDNTKLVDDTYVKDIIGETNPKKIEV
IPLIEDRDSMLRIDTIVGKYIEIERPPYLRVFLARSDPAMNYGLLSAVLSVKYALSRLSK
MEKIYGVKIFPLLGVGSLPFRGHFSPYNVENTLNEYRGIYTFTVQSAFKYDYEDDLVISA
IKKVNGTNVTEKIELSEEDEEIISNVTRKYTQGYQNKIEALADVINKVALLLPRRRARKL
HIGLFGYSRSTGKVTLPRAISFVGSLYTIGIPPEIIGLSSLSKMTNQELHAIFSNYKYLK
NDLQFAARFVNLEGLQLLKDIWSVDAEVVKAIKEDIDYAENNLGIRIGESDYMSKKHVLL
STLALLSIKEGKLDEAKTYIKEMAIVRRAIG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatacctaggactatgtcaacacagcaccctgataacgcaaaagttcctgaa
tggaaccaaggagaagcaatcagcggtgaaaacgagattattgaggcatatttggctttt
tccagatatggcgtggaagaggtgatgtgggatgccgaaggtaaggacgtggacactcat
gtagtgagaaaattactaagtcaatacccagaatttttcagacacaggatattaggcaag
gatattttcttgacgtatagggttccaaatccaaaaatagagggtgctgagagaaaagtc
tttgctgaaacgctaaatactataccaataacatatgacttagctgagaagttttatggc
gaaaatcctaatccaccagtctttgaagttatcttaccttttacaactagttatgaagag
ttaattgcagtcatcaagttttatgagaaagtaatagttaacagtgacaatacgaagcta
gttgatgatacatatgtgaaggatattataggtgagacaaatcctaagaagatcgaagta
attcctctaatagaagatagagattcaatgttaagaatagatacaatagttgggaaatac
atagaaatagagagaccaccttatctgagagtgttcttagcaagatctgatccagctatg
aattatggtttgttgtcagctgttctatcagtgaaatacgcattaagcagactttcgaaa
atggaaaagatttatggagtgaagatatttcctttactcggagtcggttctttacccttc
agaggtcattttagtccatataatgttgaaaatactttgaatgaatacagaggcatatat
acctttactgttcaatcagctttcaaatatgactatgaagatgaccttgtgatcagtgca
ataaagaaagtaaatgggactaacgtaaccgaaaaaattgaattaagtgaggaagatgag
gagatcatttctaacgtaacaagaaaatacacacaaggttatcagaataagatagaggca
ttagccgatgttataaacaaagtggcattactacttcctagaagaagagccagaaaattg
cacataggtttatttggatattcaagaagtacaggtaaggtaacactacctagagctatt
tcctttgttggctctctatatactataggtattccacctgagattatagggctttcctct
ctatcaaaaatgactaatcaagagcttcatgccatattcagtaattacaaatatttgaag
aatgatctgcagttcgcagcccgttttgttaacttagaaggtctccagttactcaaagat
atatggagtgttgatgcagaggttgtcaaagctataaaggaagatatagactatgcagaa
aataatctgggaattagaataggcgaaagtgattatatgagcaaaaaacacgttctactc
tctaccctggcactattgtccataaaagagggtaaattggacgaggctaaaacgtatata
aaagaaatggctatagtaagaagagcaataggatga

DBGET integrated database retrieval system