KEGG   Sulfolobus acidocaldarius SUSAZ: SUSAZ_03380Help
Entry
SUSAZ_03380       CDS       T02975                                 

Definition
(GenBank) alpha-aminoadipate--lysW ligase
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
sacs  Sulfolobus acidocaldarius SUSAZ
Pathway
sacs00300  Lysine biosynthesis
sacs01100  Metabolic pathways
sacs01210  2-Oxocarboxylic acid metabolism
sacs01230  Biosynthesis of amino acids
Module
sacs_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:sacs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SUSAZ_03380
Enzymes [BR:sacs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     SUSAZ_03380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK GSH-S_ATP CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_5 ATP-grasp Ins134_P3_kin ATP-grasp_2 Dala_Dala_lig_C Fungal_lectin
Motif
Other DBs
NCBI-ProteinID: AHC51114
UniProt: V9S805
LinkDB All DBs
Position
552722..553579
Genome map
AA seq 285 aa AA seqDB search
MIIGVSYDLLRWEEKDIITEARKSGFKAIPIFTKDFYSIVGVGENHNELEADVIIQRNTS
HARALTTSLIFEGWNYNVVNDATSLFKCGNKLYTLSLLAKHNIKTPRTVVTFSKDKAVDL
AKKIGFPAVIKPIEGSWGRMVAKAVDEDILYSFLEYQEYTTSQFRQIYLVQEFVKKPNRD
IRIFVMGDEAPVGIYRVNEHNWKTNTALGARALPLKIDDELRDLALKVRDIMGGFFLGID
IFEDPERGYLVNEINGVPEYKNTVRVNNFNVSSYLLNKLREWIKK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgataataggggtatcatacgacctgctgagatgggaagagaaggacataataactgaa
gcgagaaaaagtggatttaaggcaattcctatatttacaaaggatttttattctatagta
ggagtaggcgaaaatcataacgaattagaggcagatgttataatacagagaaatactagt
catgcaagggcattaaccacatctttaatttttgagggatggaattataatgtagtaaat
gatgcgacaagtttgtttaaatgcggtaacaaactgtatacattatctttattagctaaa
cataatattaagactcctagaactgttgtaactttttcaaaagataaagctgttgattta
gctaaaaaaattggatttcctgccgtaataaaaccaatagaaggtagttggggaagaatg
gttgcgaaggctgtagatgaagacattttatatagctttctagaatatcaggaatataca
acaagtcaatttaggcagatctatttagtacaagaatttgttaaaaaaccaaatagagac
attagaatatttgtaatgggagatgaggcgccagttggaatatatagagttaatgaacat
aactggaaaacaaatacggcattaggtgccagagctttaccgttaaaaatagatgacgaa
ctaagggatttagctcttaaagtgagagatataatgggtggattctttttgggtatagat
atttttgaggatcctgaaaggggatatttagtgaatgagataaatggtgtaccggaatat
aaaaatactgtaagagttaataatttcaatgtatcgtcataccttttaaataaacttaga
gagtggattaagaaatga

DBGET integrated database retrieval system