KEGG   Sulfolobus acidocaldarius SUSAZ: SUSAZ_03555Help
Entry
SUSAZ_03555       CDS       T02975                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sacs  Sulfolobus acidocaldarius SUSAZ
Pathway
sacs03030  DNA replication
sacs03410  Base excision repair
sacs03420  Nucleotide excision repair
sacs03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sacs00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SUSAZ_03555
   03410 Base excision repair
    SUSAZ_03555
   03420 Nucleotide excision repair
    SUSAZ_03555
   03430 Mismatch repair
    SUSAZ_03555
Enzymes [BR:sacs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SUSAZ_03555
    6.5.1.6  DNA ligase (ATP or NAD+)
     SUSAZ_03555
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SUSAZ_03555
DNA replication proteins [BR:sacs03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SUSAZ_03555
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SUSAZ_03555
DNA repair and recombination proteins [BR:sacs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SUSAZ_03555
   NER (nucleotide excision repair)
    Other NER factors
     SUSAZ_03555
   MMR (mismatch exicision repair)
    Other MMR factors
     SUSAZ_03555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AHC51140
UniProt: V9S4T2
LinkDB All DBs
Position
complement(580182..581978)
Genome map
AA seq 598 aa AA seqDB search
MEFKLIAEYFDRLEKISSRIQLTALLTDLLKKSDKEIIDKVIYITQGKLWPDFFEKPEIG
LGEKLMIKALSVSTNIKEDEIEKQLRILGDLGEVAYKLKRTNSSQNVLSYLGSTKVTKLT
VEEVYESLSKIALSEGEGSRDMKIRSLAGLLKKADPLEAKYIIRFIDGRLRVGIGDATIM
DALANVFGGGTAARPLIERAYNLRADLGNIAKLLAENGIEAIKSIKPEVGIPIRPMLAER
LTDPSEILAKVGGKGIVDYKYDGERAQIHKKGEKVYIFSRRLENITKQYPDVVEYIKNCI
KSNEVILEGEIVAIDKESGEILPFQNLMHRKRKNDIGEAIKEYPINVYLFDLMYNDGEDY
TQKPLPDRREKLEEIVTQNDIVKVADHKYIDKVNELVEYFHQAISDGTEGVIVKSVGKDS
IYQAGARGFLWIKLKKDYQSEMADSVDLVIVGAFYGRGKRGGKLSSLLMAAYDPDKDTFY
TVCKVASGFSDAELEEVQKMLSDAKLDKKDPRVESEIQPDIWVKPKYVAEIIGAEITLSP
LHTCCKGVVSEEAGLSIRFPRFIRWRDDKSVEEATTPNEILEMYQSRLKKKVEDITET
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
gtggagtttaaattaattgctgaatattttgacagattggaaaaaatttcatcaagaatt
caactcacagctctcttaacggatttgttaaagaaatcagataaggaaataatagataaa
gtaatatatattactcaaggtaaattgtggccagatttctttgaaaagcctgaaatcgga
cttggagaaaaacttatgattaaagcactctcggtttcaactaacataaaagaagatgaa
attgaaaagcaattacgaattctaggtgacctaggagaggtagcttacaaacttaagaga
actaattcatcacaaaatgtcctatcgtatttaggttccactaaggtaactaagctaact
gtagaagaggtttatgaatcactgagtaagatagcattgtctgagggagaaggaagtaga
gatatgaaaatacgttccctagcagggctcctcaaaaaagctgatccattggaggctaaa
tacataattagattcattgatggtagattgagagttggcataggtgatgccacaatcatg
gacgcgttagcaaatgtatttggtggtggaactgcggcacggccattaatagaacgcgca
tataatttgagagctgatctaggaaatatagctaagcttttagcagaaaatggcatagaa
gctataaagtcgattaaaccagaggttggaataccgattagacctatgcttgctgaaaga
ttaacagacccatcagaaatattagccaaagttggcggtaaaggaatagtagactataag
tatgatggagagagagctcaaattcacaaaaaaggtgagaaagtttatatcttctctaga
cgattagagaatataaccaaacagtacccagacgttgttgaatacattaaaaattgtatc
aagagtaatgaagttattctggaaggagaaatagttgcgatagataaagaaagtggagag
attcttcccttccagaacctaatgcataggaaaagaaagaatgatataggtgaggctata
aaggagtatccgatcaatgtatacttatttgatctcatgtataatgacggtgaagattat
acgcaaaaacccttaccagacagaagagaaaaattagaggaaattgtaacacagaacgat
atagttaaggttgcagatcacaaatatattgataaagtcaatgagttggtagagtatttc
catcaggctattagcgatggtacagaaggtgttatagtaaaatctgtaggtaaagactca
atatatcaagcaggagccaggggatttttatggataaaattaaagaaagactatcaaagt
gaaatggctgatagcgttgatctggttattgtgggagctttttatggcaggggtaaaagg
ggaggtaaactgagttccttattaatggcagcatatgatccagataaagatactttctat
accgtgtgtaaagtagcatcaggcttcagtgatgctgaattagaggaagtacaaaagatg
ttatctgacgctaaactagataaaaaagatcctagagtggaatctgaaatacaaccagat
atatgggtaaaaccaaaatacgtagctgaaatcattggcgccgaaataacgttatctcca
ttacatacttgttgcaaaggtgttgtttcagaggaagctggtttatccataagatttcca
cgcttcataagatggagagatgataaaagcgttgaagaagccacaacgccaaatgagata
ttagagatgtatcagagtagactgaaaaagaaagttgaagatataacagagacatag

DBGET integrated database retrieval system