KEGG   Stenotrophomonas acidaminiphila: AOT14_01810Help
Entry
AOT14_01810       CDS       T04107                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
sacz00360  Phenylalanine metabolism
sacz00362  Benzoate degradation
sacz00650  Butanoate metabolism
sacz01100  Metabolic pathways
sacz01120  Microbial metabolism in diverse environments
sacz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AOT14_01810
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AOT14_01810
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOT14_01810
Enzymes [BR:sacz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     AOT14_01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 UDPG_MGDP_dh_N NAD_Gly3P_dh_N AlaDh_PNT_C DUF4012 2-Hacid_dh_C Glyco_hydro_4
Motif
Other DBs
NCBI-ProteinID: ALJ26642
UniProt: A0A0R0DZ09
LinkDB All DBs
Position
complement(219308..220174)
Genome map
AA seq 288 aa AA seqDB search
MDKINKVTVLGTGVLGSQIAFQTAYSGFEVSVYDIDEAAIAKARQRLDGLFETYEEEVAG
ADGDKLHAALARIALHTDLGAAVADADLVIEAIPEVLELKRQTYARLDRLAPEKTIFATN
SSTLLPSAIQDATGRPDRFIALHFANQIWKYNTAEVMGTQDTDPKVFDALLAFAADIGMV
PIALHKEKAGYVLNSLLVPLLNAAAELAAGGYADPHDVDKVWRIATGAPLGPFQIYDIIG
LTTPYNILSHGNTHTQQLAAWLKEHYIDHGKLGVASGEGFYRYDKTPN
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttggacaagattaacaaggtgacggtgctgggcacgggcgtgctgggttcgcagatcgcg
ttccagaccgcctacagcggcttcgaggtatcggtctacgacatcgacgaggcggccatc
gccaaggcgcggcagcgcctggacgggctgttcgaaacctacgaggaggaggtggccggc
gccgacggcgacaagctgcacgccgcattggcgcgcatcgccttgcacaccgacctgggt
gcggccgtggccgatgccgacctggtgatcgaggccatccccgaagtgctggaactcaag
cgccagacctacgccaggctggaccggctggcgccggagaagaccatcttcgccaccaac
tcgtccacgctgctgccgagcgcgatccaggacgccaccggccgacccgaccgcttcatc
gccctgcatttcgccaaccagatctggaagtacaacaccgccgaggtgatgggcacgcag
gacaccgacccgaaggtgttcgacgcgctgctggctttcgccgccgacatcggcatggtg
cccatcgcgctgcataaagaaaaagcgggctacgtgctcaactcgctgctggtgccgctg
ctcaacgcggccgccgagctggccgccggcggctatgccgacccgcacgacgtggacaag
gtctggcgcatcgccaccggcgcgccgctggggccgttccagatctacgacatcatcggc
ctgactacgccctacaacatcctgtcccacggcaacacccacacccagcagctggcggcc
tggctgaaggagcactacatcgaccacggcaagctcggcgtcgcctccggcgagggcttc
taccgctacgacaagaccccgaactga

DBGET integrated database retrieval system