KEGG   Stenotrophomonas acidaminiphila: AOT14_04090Help
Entry
AOT14_04090       CDS       T04107                                 

Gene name
sodC_2
Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sacz  Stenotrophomonas acidaminiphila
Brite
Enzymes [BR:sacz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AOT14_04090 (sodC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ALJ26861
UniProt: A0A0R0DN31
LinkDB All DBs
Position
482435..483067
Genome map
AA seq 210 aa AA seqDB search
MRLIHTSLFLASALVLSACKQDAEPAATPAGTAPEAAAGTPAPATDPAADPATPPAMEAA
VATAELQPTKDSTVKGSIRFTLVDGRLHASGDISGLKPGSEHGFHIHEKGDCSAPDGSSA
GGHFNPGNAEHGSIDAAAHHGGDMPNIVADAQGNARVDGPVSSNVNAGKGDGFDIIGRGL
IVHADPDDYHSQPTGNAGARLACAVIAKAE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgatccacaccagcctgttcctcgccagcgccctggtgctgagcgcctgcaag
caggacgccgaaccggccgccacgccggccggtaccgcgcccgaggctgcggccggcacc
ccggctccagccaccgacccggccgccgacccggccacgccgccggcgatggaggccgcc
gtggccaccgccgaactgcagccgaccaaggacagcaccgtcaagggcagcatccgcttc
accctggtggacggcaggctgcatgccagcggcgacatcagcgggctcaagccgggcagc
gagcacggtttccacatccacgagaagggcgactgcagcgcgccggacggcagcagcgcc
ggcggccacttcaacccgggcaacgccgagcacggcagcatcgacgcggccgcgcaccat
ggcggcgacatgcccaacatcgtcgccgacgcgcagggcaatgcccgcgtggacggcccg
gtgtcgagcaacgtcaacgccggcaagggcgatggcttcgacatcatcggccgcggcctg
atcgtccatgccgacccggacgattaccacagccagcccaccggcaacgccggtgcgcgc
ctggcctgcgcggtgatcgccaaggccgagtaa

DBGET integrated database retrieval system