KEGG   Stenotrophomonas acidaminiphila: AOT14_05860Help
Entry
AOT14_05860       CDS       T04107                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
sacz00061  Fatty acid biosynthesis
sacz01100  Metabolic pathways
sacz01212  Fatty acid metabolism
Module
sacz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AOT14_05860 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sacz01004]
    AOT14_05860 (fabA)
Enzymes [BR:sacz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AOT14_05860 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     AOT14_05860 (fabA)
Lipid biosynthesis proteins [BR:sacz01004]
 Fatty acid synthase
  Component type
   AOT14_05860 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ALJ27026
UniProt: A0A0R0EA90
LinkDB All DBs
Position
complement(666356..666871)
Genome map
AA seq 171 aa AA seqDB search
MNRLNAFSREQLLASARGELFGPNKGRLPNDPMLMFDRITDIRDDGGPHGKGLVRAELDI
RPDLWFFGCHFIGDPVMPGCLGLDAMWQLTGFFLTWLGAEGRGRALGCGEVKFTGQVLPS
ARLVQYEIDISRVINRKLVMAQADARMLVDGREIYTAKDLRVGLFTSTESF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtctcaatgcgttctcgcgcgaacagctgctggccagtgcccgcggcgagctg
ttcgggcccaacaagggccgcctgcccaacgacccgatgctgatgttcgaccgcatcacc
gacatccgcgacgacggggggccccacggcaagggcctggtgcgcgccgagctcgatatc
cgccccgacctgtggttcttcggctgccacttcatcggcgacccggtgatgcccggctgc
ctcggcctggatgcgatgtggcagctgaccggcttcttcctgacctggctgggcgccgag
gggcgcggccgcgccctgggctgcggtgaggtcaagttcaccggccaggtgctgcccagc
gccaggctggtgcaatatgaaatcgacatttcgcgcgtgatcaaccgcaagctggtcatg
gcccaggccgacgcccgcatgctggtcgacgggcgcgagatttataccgccaaggacctg
cgcgtgggcctgttcacttccaccgagagcttctga

DBGET integrated database retrieval system