KEGG   Stenotrophomonas acidaminiphila: AOT14_12840Help
Entry
AOT14_12840       CDS       T04107                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
sacz00071  Fatty acid degradation
sacz00280  Valine, leucine and isoleucine degradation
sacz00281  Geraniol degradation
sacz00310  Lysine degradation
sacz00362  Benzoate degradation
sacz00380  Tryptophan metabolism
sacz00410  beta-Alanine metabolism
sacz00640  Propanoate metabolism
sacz00650  Butanoate metabolism
sacz00903  Limonene and pinene degradation
sacz00930  Caprolactam degradation
sacz01100  Metabolic pathways
sacz01110  Biosynthesis of secondary metabolites
sacz01120  Microbial metabolism in diverse environments
sacz01130  Biosynthesis of antibiotics
sacz01200  Carbon metabolism
sacz01212  Fatty acid metabolism
Module
sacz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AOT14_12840
   00650 Butanoate metabolism
    AOT14_12840
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOT14_12840
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOT14_12840
   00310 Lysine degradation
    AOT14_12840
   00380 Tryptophan metabolism
    AOT14_12840
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOT14_12840
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AOT14_12840
   00281 Geraniol degradation
    AOT14_12840
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOT14_12840
   00930 Caprolactam degradation
    AOT14_12840
Enzymes [BR:sacz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AOT14_12840
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AOT14_12840
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AOT14_12840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Pyr_redox_2 ApbA MORN AlaDh_PNT_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ALJ27687
UniProt: A0A0S1AY15
LinkDB All DBs
Position
complement(1447387..1449450)
Genome map
AA seq 687 aa AA seqDB search
MLSGFDGLRFTHWQAEIRDDGFVVLALDRRDSPVNAMSQDVLLELGDIVERLAIDPPKGV
VVRSAKAAGFIAGADLKEFQEFDRRGTVNDAIRRGQSTYQKLAELPCPTVAAIHGHCLGG
GTELALACRYRVASSDPSTRIGLPETQLGIFPGWGGSARLPRLVGAPAAMDMMLTGRTLS
ASAARGIGLVDKVAAPAVLIDAAISLLQSGVTRPFKQRATAWATNTWLARKILAPQMAKQ
VARKAKKEHYPAPYALISTWERSGGSGIQARLDAERRAVVKLAGGPTARNLIRIFFLTER
LKALGGKASDIRHVHVVGAGVMGGDIAAWAAYKGFDVTLQDREQRFIDPAMARAQALFEK
KVKDPARRPEVAARLKPDLAGDGVASADLVIEAIIENPEAKRELYQALEPRLKADALLTT
NTSSIPLDELREHIAQPARFAGLHYFNPVAQMPLVEIIHHDRMAPETEQRLAAFCKALGK
FPVPVAGTPGFLVNRVLFPYMLEAATAYAEGIPGPVIDRAAVRFGMPMGPIELLDTVGLD
VAASVGRELAPFLGLQIPAALAAVEPGKRGKKDGQGIYKWENGRAVKPEVARDYQAPSDL
EDRLILPLLNEAVACLHDGVVADADLLDAGVIFGTGFAPFRGGPIQHVRATGADALVEKL
RTLQARHGDRFAPRPGWDMPVLRAPIA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgctttcaggtttcgatgggctccgcttcactcactggcaggccgagatccgcgacgac
ggcttcgtcgtgctcgccctggaccgccgcgacagtccggtcaacgcgatgtcacaggac
gtgctgctggagctgggcgacatcgtcgaacggctggcgatcgacccgcccaagggggtg
gtggtccgctcggccaaggccgccggcttcatcgccggcgccgacctcaaggagttccag
gagttcgaccgccgcggcaccgtcaacgacgccatccgccgcggccagtccacctaccag
aaactggcagagctgccctgccccaccgtcgccgcgatccacggccactgcctgggcggc
ggcaccgaactggccctggcctgccgctaccgcgtggcgtccagcgatccgtccacccgc
atcggcctgcccgagacccagctgggcatcttcccgggctggggcggcagcgcgcgcctg
ccgcgcctggtcggcgccccggcggcgatggacatgatgctgaccgggcgcaccctgtcg
gcctcggccgcacgcggcatcggcctggtcgacaaggtcgccgcaccggcggtcctgatc
gacgcggcgatatcgctgctgcagtcgggcgtgacccggccgttcaagcagcgcgccacc
gcctgggctaccaacacctggctcgcacgcaagatcctggcgccgcagatggccaagcag
gtcgcgcgcaaggcgaagaaggaacattacccggcaccatacgcattgatctcgacctgg
gagcgcagcggcggcagcggcatccaggcacgtctggacgccgagcgccgcgcggtggtc
aagctggccggcggcccgaccgcgcgcaacctgatccgcatcttcttcctgaccgagcgg
ctcaaggcgctgggcggcaaggcgtcggacatccgccacgtacacgtggtcggtgccggg
gtgatgggcggcgacatcgccgcgtgggcggcctacaagggcttcgacgtgaccctgcag
gaccgcgaacagcgcttcatcgacccggccatggcacgtgcccaggccctgttcgagaaa
aaggtgaaggatccggccaggcgcccggaagtggcggcacggctgaagcccgacctggcc
ggcgacggcgtggccagcgccgacctggtgatcgaggcgatcatcgagaaccccgaagcc
aagcgcgagctgtaccaggcgctggagccgcgcctgaaggccgacgcgctgctgaccacc
aacacctcctcgatcccgctggacgagctgcgcgaacacatcgcgcagccggcccggttc
gccggcctgcactacttcaacccggtggcgcagatgccgctggtggagatcatccaccac
gaccgcatggcaccggagaccgaacagcggctggccgcattctgcaaggcgctgggcaag
ttcccggtgccggtggccggcacccccgggttcctggtcaaccgcgtgctgttcccgtac
atgctggaggcggccaccgcctatgccgaaggcatccccggcccggtgatcgaccgcgcc
gcggtgaggttcggcatgccgatgggcccgatcgaactgctcgacaccgtcggcctggac
gtggccgccagcgtcggcagggagctggcgccgttcctgggcctgcagatcccggccgcg
ctggccgccgtggaaccgggcaagcgcggcaagaaggatggccagggcatctacaagtgg
gagaacggccgcgcggtgaagccggaagtggccagggactaccaggcgccgtcggacctg
gaggaccgcctgatcctgccgctgctcaacgaggcggtggcctgcctgcacgatggcgtg
gtggccgatgccgacctgctcgatgccggggtgatcttcggtaccggcttcgcgccgttc
cgcggcggcccgatccagcacgtccgcgccaccggcgccgatgccctggtggaaaaactc
cggaccctgcaggcacgccacggcgaccgtttcgcaccgcgtccgggctgggacatgccg
gtcctgcgcgcacccattgcctga

DBGET integrated database retrieval system