KEGG   Stenotrophomonas acidaminiphila: AOT14_16560Help
Entry
AOT14_16560       CDS       T04107                                 

Gene name
sdhA_2
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
sacz00020  Citrate cycle (TCA cycle)
sacz00190  Oxidative phosphorylation
sacz00650  Butanoate metabolism
sacz01100  Metabolic pathways
sacz01110  Biosynthesis of secondary metabolites
sacz01120  Microbial metabolism in diverse environments
sacz01130  Biosynthesis of antibiotics
sacz01200  Carbon metabolism
Module
sacz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sacz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sacz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOT14_16560 (sdhA_2)
   00650 Butanoate metabolism
    AOT14_16560 (sdhA_2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AOT14_16560 (sdhA_2)
Enzymes [BR:sacz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AOT14_16560 (sdhA_2)
    1.3.5.4  fumarate reductase (quinol)
     AOT14_16560 (sdhA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ALJ28044
UniProt: A0A0R0DRQ7
LinkDB All DBs
Position
1837753..1839543
Genome map
AA seq 596 aa AA seqDB search
MSAYNITEHKVDMVVVGAGGAGLRATFGLAQKGLQTVCITKVFPTRSHTVAAQGGISAAL
GNMGEDDWRYHFYDTIKGSDWLGDQDAIEYMVREAIPAIIELEHYGVPFSRTEDGKIYQR
PFGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGV
CRGVLALDMAEGTLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVARAGLPLQDM
EFVQFHPTGIYGAGCLITEGVRGEGGILRNSSGERFMERYAPHYKDLASRDVVSRSMTIE
IREGRGVGEHKDHILLDLTHLGPGVIDEKLPGIAESARIFAGVDVHKQPIPVIPTVHYNM
GGIPTNYHGEVVRKVGDNPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVAN
RCAETIKPGAPHKTLGSDACDKALGLLDKLRHANGDTPTAVIRDRMQRTMQADAAVFRTS
KTLAEGCTKMAEVFDSFQDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESR
GAHAHEDYPERDDANWMKHTLVTVDEKGKCSFDYRPVHMYTLTDDVAVVPPKPRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttacaacatcactgaacacaaggtcgacatggtggtcgtcggcgccggcggc
gccggcctgcgcgcgaccttcggcctggcccagaagggcctgcagaccgtgtgcatcacc
aaggtcttcccgacccgctcgcacaccgttgcggcgcagggcggcatttccgccgcgctg
ggcaacatgggcgaggacgactggcgctaccacttctacgacaccatcaagggttcggac
tggctgggcgaccaggacgctatcgaatacatggtgcgcgaggcgatcccggcgatcatc
gagctggaacactacggcgttccgttcagccgcaccgaggacggcaagatctaccagcgt
ccgttcggtggcatgaccaccaagtacggcgaaggcccgtccgcgcagcgcacctgcgcc
gccgccgaccgtaccggccacgccatgctgcacaccctgtaccagcagtcgctggcgcac
aacgcgcgcttcatgatcgagtacttcgcgctcgacctgatcttcgacgaagagggcgtg
tgccgcggcgtgctggcgctggacatggccgagggcaccctgcacctgttccgcgcccat
ggcgtggtgctggccaccggcggctacggccgtgcctatttcagcgccacctcggcgcac
acctgtaccggtgacggcggcggcctcgtggcccgtgccgggctgccgctgcaggacatg
gaattcgtgcagttccacccgaccggcatctacggcgccggctgcctgatcaccgaaggc
gtgcgcggcgaaggcggcatcctgcgcaacagcagcggcgagcgcttcatggagcgctac
gcaccgcattacaaggacctggcctcgcgcgacgtggtcagccgttcgatgaccatcgag
atccgcgaaggccgcggcgtcggcgagcacaaggaccacatcctgctcgacctgacccac
ctgggcccgggcgtgatcgacgagaagctgccgggcatcgccgagagcgcgcgcatcttc
gccggcgtcgacgtgcacaagcagccgatcccggtgatcccgaccgtgcactacaacatg
ggcggcatcccgaccaactaccacggcgaagtggtgcgcaaggtcggcgacaaccccgat
gcggtggtgccgggcctgtacgccatcggcgaggcggcctgcgtgtcggtgcatggcgcc
aaccgcctgggctccaactcgctgctcgacctggtggtgttcggccgcgctgtggccaac
cgctgcgccgagaccatcaagccgggcgcgccgcacaagaccctgggttcggacgcctgc
gacaaggcgctgggcctgctggacaagctgcgccatgccaatggcgacaccccgaccgcc
gtcatccgcgaccgcatgcagcgcacgatgcaggccgacgccgcggtgttccgcaccagc
aagacgctggccgagggctgcaccaagatggccgaagtgttcgattcgttccaggacgtc
aaggtctccgaccgctcgctggtctggaactcggacctgatcgagacctacgagctcaac
aacctgctgctcaacgccgtggccaccatcaactcggccgagcagcgcaaggaaagccgc
ggcgcgcatgcgcacgaggactatccggagcgcgacgacgccaactggatgaagcacacg
ctggtcaccgtcgacgagaagggcaagtgcagcttcgactaccgtccggtgcacatgtac
acgctcaccgacgacgttgccgtcgtgccgccgaagccgcgcgtctactga

DBGET integrated database retrieval system