KEGG   Stenotrophomonas acidaminiphila: AOT14_16570Help
Entry
AOT14_16570       CDS       T04107                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
sacz00020  Citrate cycle (TCA cycle)
sacz00190  Oxidative phosphorylation
sacz00650  Butanoate metabolism
sacz01100  Metabolic pathways
sacz01110  Biosynthesis of secondary metabolites
sacz01120  Microbial metabolism in diverse environments
sacz01130  Biosynthesis of antibiotics
sacz01200  Carbon metabolism
Module
sacz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sacz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sacz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOT14_16570 (sdhB)
   00650 Butanoate metabolism
    AOT14_16570 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AOT14_16570 (sdhB)
Enzymes [BR:sacz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AOT14_16570 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AOT14_16570 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: ALJ28045
UniProt: A0A0S1AZ38
LinkDB All DBs
Position
1839562..1840347
Genome map
AA seq 261 aa AA seqDB search
MAEFALPKNSRVTQGKHFPAKSGGKNVRTFKIYRWSPDDDQNPRTDTYEVDLDACGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGTNTLACTRAISDCTKAEVPIYPLPHM
DVVKDLVPDLTHFYAQYASIKPWIRTQTPAPSDRERLQSPEDRKKLDGLYECILCACCST
SCPSYWWNGERYLGPAILLQAYRWIIDSRDEDTGARLDDLEDPFKLYRCHTIMNCARTCP
KGLNPALAIAEIKKLMMARRA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatttgcactcccgaagaactcccgggtcacccagggcaagcacttccccgcc
aagagcggcggcaagaacgtgcgcaccttcaagatctaccgctggagtccggacgacgac
cagaacccgcgtaccgacacctacgaggtcgacctcgacgcgtgcggcccgatggtcctg
gacgcgctgatcaagatcaagaacgagatcgacccgaccctgaccttccgccggtcctgc
cgcgagggcatctgcggttcgtgcgcgatgaacatcgacggcaccaacacgctggcctgc
acccgcgccatctccgactgcaccaaggccgaggtgccgatctacccgctgccgcacatg
gatgtggtcaaggacctggtgccggacctgacccacttctacgcgcagtacgcgtcgatc
aagccgtggatccgcacccagaccccggctccgtcggaccgcgagcgcctgcagtcgccg
gaagaccgcaagaagctcgacggcctgtacgagtgcatcctgtgcgcctgctgctcgacc
agctgcccgagctactggtggaacggcgaacgctacctgggcccggcgatcctgctgcag
gcctaccgctggatcatcgactcgcgcgacgaggacaccggtgcgcgcctggacgatctg
gaggatccgttcaagctgtaccgctgccacaccatcatgaactgcgcccggacctgcccg
aaggggttgaacccggcactggcgatcgccgagatcaagaagttgatgatggcgcgccgc
gcctga

DBGET integrated database retrieval system