KEGG   Stenotrophomonas acidaminiphila: AOT14_20620Help
Entry
AOT14_20620       CDS       T04107                                 

Definition
(GenBank) amino-acid transporter transmembrane protein
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
sacz  Stenotrophomonas acidaminiphila
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AOT14_20620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: ALJ28437
UniProt: A0A0R0DZW6
LinkDB All DBs
Position
2276408..2277886
Genome map
AA seq 492 aa AA seqDB search
MLKTLLRVKPVEPAAHVDAGEPVEGSLQGEATLKRTLTARHLILLGMGAVIGAGIFVITG
QAAAHHAGPAIMLSFVLAGLACAFAGLCYAEFAAMMPVSGSAYSYSYATLGEGMAWFIGW
CLVLEYLFASSSVAVGWSAYLLSFLTSTLHLPFPEALTAAPIAWENGQFVASGKLLNLPA
VLIIAVISGLLYVGVTQSTFVNAVIVAIKVAVICLFVGFGAMYVNPENWTPFIPDNTTGV
FGEFGWSGVFRAASIVFFAYIGFDAVSTAAGETKNPQRNMPIGLLGSLAVCTIIYIVVCA
VMTGLMHYTKLGTDKPVATALEAYANLAWLKTWVEIGAIAGLSSVVLVMMMGQTRIAYTI
SRDGLLPEIFGRVHPKFRTPHLSTVIVGALAAALAGLVPLNVLGELVAMGTLLAFATVCI
GVLILRRTRPEMPRAFRVPAVWLVAPLGALICLSLFAMAFAAHWLVFVLWNVLGVAIYLG
YGMRHSKLNRNA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaacactgttgagggtcaaaccggtcgagccggccgcacacgtggacgccggc
gagccggtcgaaggcagcctgcagggcgaagccacgctcaagcgcaccctcacagccagg
cacctgatcctgttgggcatgggcgcggtgatcggcgccggcatcttcgtcatcaccggg
caggcggcggcccaccacgccggccccgcgatcatgctgtcgttcgtgctcgccggcctg
gcctgcgccttcgccggcctgtgctacgcggagttcgcggcgatgatgccggtctccggc
agcgcctattcctactcgtacgccaccctcggcgaaggcatggcctggttcatcggctgg
tgcctggtactggagtacctgttcgcgtcctcgtcggtggcggtgggctggtcggcctat
ctgctcagtttcctcaccagtaccctgcacctgcccttccccgaggcgctgactgccgcg
ccgatcgcatgggagaacggccagttcgtcgcctccggcaaactgcttaacctgccggcg
gtactgatcatcgcggtgatctcggggctgctgtacgtcggcgtgacccagtccaccttc
gtcaatgcggtgatcgtcgcgatcaaggtggcggtgatctgcctgttcgtcggcttcggc
gcgatgtacgtcaatcccgagaactggacgcccttcatcccggacaacaccaccggcgtg
ttcggcgagttcggctggagcggggtgttccgcgccgcgtccatcgtcttcttcgcctac
atcggtttcgatgcggtctccaccgccgccggcgagaccaagaacccgcagcggaacatg
ccgatcggcctgctcggctcgctggcggtgtgcacgatcatctacatcgtggtctgcgcg
gtgatgaccggcctcatgcactacaccaagctgggcaccgacaagccggtggccaccgcg
ctggaggcctatgccaacctggcgtggctcaagacctgggtcgagatcggcgccatcgcc
ggcctgtcctcggtggtgctggtgatgatgatgggccagacccgcatcgcctacaccatt
tcccgcgacggcctgctgccggagatattcggccgggtgcatccgaagttccgcacgccg
cacctgagcaccgtgatcgtcggcgcactggccgccgcgctggccggcctggtgccgttg
aacgtgctgggcgaactggtcgccatgggcaccctgctggcgttcgccacggtctgcatc
ggggtgctgatcctgcgccgcacccgcccggaaatgccgcgcgcgttccgggtgcccgcc
gtgtggctggtcgcgccgctgggcgcgctgatctgcctgagcctgttcgcgatggccttc
gccgcgcactggctggtgttcgtgctgtggaacgtactgggcgtagccatctacctgggc
tacggcatgcgccacagcaaactgaaccggaacgcctga

DBGET integrated database retrieval system