KEGG   Stenotrophomonas acidaminiphila: AOT14_29240Help
Entry
AOT14_29240       CDS       T04107                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sacz  Stenotrophomonas acidaminiphila
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOT14_29240 (ahpF)
Enzymes [BR:sacz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AOT14_29240 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 DAO HI0933_like AlaDh_PNT_C FAD_oxidored Glutaredoxin FAD_binding_3 NAD_binding_8 K_oxygenase Thi4 FMO-like
Motif
Other DBs
NCBI-ProteinID: ALJ29276
UniProt: A0A0S1B2I5
LinkDB All DBs
Position
3237914..3239506
Genome map
AA seq 530 aa AA seqDB search
MLDDTLKTQLQQYMGLLRQPLRLIASLDDSAASTDMRGLLDDIVAAGNGKITLDTSGSDA
RRPSFVIAREGESHGVRFAGLPLGHEFESLVLALLWTGGHPPKVAQEVIDGIKAVDGEFA
FEVYMSLTCHNCPDVVQALALMAIVNPKISTTVIEGGTFQQEVEQRQVMAVPMVFQGGEM
FDSGRMTLEQILARLDTGAARREAAKIAAKDPFDVLVVGGGPAGAAAAIYAARKGIRTGV
AAERFGGQVLDTMAIENFISVQYTEGPKLAAALEQHVREYEVDIMNLQRATKLVPAGADG
LVEVQLENGASLKSKSVILSTGARWRQMNVPGEDAYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTVFEFDSKLRADQVLQAKLHSLPNVTVVLNAQTTEVLGDG
QKVSGLVYTDRVGGDSHRVELEGIFVQIGLLPNTEWLRGTLELSPRGEIVIDERGQTSVP
GVFAAGDCTTVPYKQIIIAMGAGSTAALSAFDHLIRSPAPQPSAAVAETA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgacgacaccctcaagacccagttgcagcagtacatgggcctgctgcgccagccg
ctgcggctgatcgcctcgctcgacgacagcgccgccagcaccgacatgcgtggcctgctg
gacgacatcgtcgccgccggcaacggcaagatcaccctggacacttcgggcagcgacgcg
cgccggccgtcgttcgtgatcgcccgcgagggcgaaagccacggcgtgcgctttgccggg
ctgccgctgggccacgagttcgaatcgctggtgctggcgctgctatggaccggcggccat
ccgccgaaggtggcgcaggaggtgatcgacggcatcaaggcggtggacggcgagttcgcc
ttcgaggtgtacatgtcgctgacctgccacaactgcccggacgtggtgcaggcgctggcg
ctgatggccatcgtcaacccgaagatcagcaccacggtgatcgagggcggcacgttccag
caggaagtggagcagcgccaggtgatggcggtgccgatggtgttccagggcggcgagatg
ttcgactccgggcgcatgaccctggagcagatcctggcgcggctggataccggcgcagcc
aggcgcgaagcggcgaagatcgccgccaaggacccgttcgacgtgctggtggtgggcggc
ggcccggccggcgcggccgcggcgatctacgccgcgcgcaagggcatccgcaccggcgtg
gcagccgagcgcttcggcggccaggtgctggacaccatggccatcgagaacttcatttcg
gtgcagtacaccgaaggcccgaagctggccgcggcgctggagcagcacgtgcgcgagtac
gaggtggacatcatgaacctgcagcgcgccaccaagctggtgccggccggtgccgatggc
ctggtggaggtgcagctggagaacggcgcgtcgctgaagtcgaagtcggtgatcctgtcc
accggtgcgcgctggcggcagatgaacgtgcccggcgaggatgcgtaccgcaacaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattccggcgtcgaggcggccatcgacctggccggcatcgtcagccacgtc
accgtgttcgagttcgacagcaagctgcgcgccgaccaggtgctgcaggccaagctgcac
agcctgcccaacgtgaccgtggtgctcaacgcgcagaccaccgaggtgctgggcgacggc
cagaaggtcagcggcctggtctacaccgaccgcgtcggcggcgattcgcaccgggtggag
ctggaaggcatcttcgtgcagatcggcctgctgccgaacaccgagtggctgcgtggcacg
ttggagttgagcccgcgcggcgagatcgtcatcgacgagcgcggccagaccagcgtgccg
ggcgtgttcgccgccggcgactgcaccacggtgccgtacaagcagatcatcattgcgatg
ggtgccggttccaccgcagcgctgagcgccttcgaccacctgatccgcagcccggcgccg
cagccgtccgcggcggtggccgagaccgcctga

DBGET integrated database retrieval system