KEGG   Stenotrophomonas acidaminiphila: AOT14_32050
Entry
AOT14_32050       CDS       T04107                                 

Definition
(GenBank) integrating conjugative element protein
Organism
sacz  Stenotrophomonas acidaminiphila
SSDB
Motif
Pfam: DUF2859
Other DBs
NCBI-ProteinID: ALJ29546
UniProt: A0A0S1B388
LinkDB
Position
3527706..3528254
AA seq 182 aa
MTKPHPAHLAFTVLLVLLAGLPLASRAGEPLIVVEDHGGTSALPYYEALNLQPRANAPAR
PPIPTPRVPATPADEAAMLPVRSTKLTPGTVARRVIEAPGLRPFAVIGDDEASRAWLQRR
GAALRERGAVGLVVNVETVQGLARLRTLAPGVPLAPVAGDDLADRLGLRHYPALITATGI
EQ
NT seq 549 nt   +upstreamnt  +downstreamnt
atgacgaaaccccatccggcccatctcgcattcacggtcctgctcgtgctgctggcaggc
ctgccgctggcctcgcgtgccggcgagccgctgatcgtggtcgaggaccatggcggcacg
tcggcgctgccgtactacgaggccctgaacctccagccgcgcgccaacgcgccggcccgg
ccacccatcccgacgccccgggttcccgccacgccagcggacgaagccgcgatgctgccg
gtgcgcagcaccaagctcacgcccggcaccgtcgcgcggcgcgtgatcgaagcgcccggc
ctgcggccgttcgcggtcatcggcgacgacgaggcttcccgggcctggttgcagcggcgc
ggcgcggctttgcgcgaacgcggcgcggtcggcctggtggtcaacgtcgagaccgtgcag
ggcctggcacggctgcgtaccctggcgccgggcgtgcccctcgcgcccgtggccggagac
gacctggccgatcgcctgggcctgcggcactacccggcgctgatcacggccaccggcatc
gagcaatga

DBGET integrated database retrieval system