KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_1116Help
Entry
SAAV_1116         CDS       T01124                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
sad00020  Citrate cycle (TCA cycle)
sad00190  Oxidative phosphorylation
sad00650  Butanoate metabolism
sad01100  Metabolic pathways
sad01110  Biosynthesis of secondary metabolites
sad01120  Microbial metabolism in diverse environments
sad01130  Biosynthesis of antibiotics
sad01200  Carbon metabolism
Module
sad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAAV_1116 (sdhA)
   00650 Butanoate metabolism
    SAAV_1116 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAAV_1116 (sdhA)
Enzymes [BR:sad01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAAV_1116 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SAAV_1116 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACY11024
LinkDB All DBs
Position
1140734..1142500
Genome map
AA seq 588 aa AA seqDB search
MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDSARGIVAQNMT
TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYISNIDRSYTDM
DESIFEKRKAEEQERFDKLLAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
ELMKRYEDIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacatcttattgttgtcggaggtggcctagcgggcttaatgtcaacaatt
aaagcggcagaaaaaggtgcacatgtagatttgttctcagttgtaccagtaaagcgttcg
cactctgtttgtgcccaaggtggcattaatggtgcggtcaatactaaaggggaaggcgat
tctccttggattcactttgatgatacagtgtatggtggcgacttccttgcaaaccaacca
cctgttaaagcgatgacagaggcagcacctaaaattattcatttattagaccgtatgggt
gtaatgttcaatagaacaaatgaaggtctattagattttagacgtttcggtggtacatta
caccacagaacagcatatgcaggggcaacaactggacaacaattattatatgcattggat
gaacaagttcgtgcatatgaagtagatggattagttacgaagtatgaaggatgggaattt
cttggcatagttaaaggtgacgatgatagtgcaagaggtatcgttgcacaaaatatgaca
actgctgagattgaaacatttggttcagatgcagttattatggcaacgggtggccctggt
attattttcggtaaaacaacaaactcaatgattaatacaggatcagcggcttccattgtt
taccaacaaggcgctatttatgctaatggtgagttcattcaaattcatcctactgcaatc
cctggtgatgataaactgcgactaatgagtgaatcagcacgtggtgaaggtggacgaatt
tggacatataaagatggtaagccttggtacttcttagaagagaaatatcctgattatggt
aacttagtacctcgtgatatcgcaacgcgtgaaattttcgatgtatgtattaaccaaaaa
ttaggtataaatggcgaaaacatggtatatcttgatttgtcacataaagatccacatgag
ttagatgtaaaactaggtggtatcattgaaatttatgaaaaattcactggtgatgaccca
cgcaaagtaccaatgaagattttcccagctgttcactattcaatgggtggtctatatgta
gattatgatcaaatgacaaatattaaagggttatttgcagctggagaatgtgacttctct
caacatggtggtaaccgcttaggtgccaattcattgttatcagcgatttatggtggtaca
gtagcaggtccaaacgcgattgattatatttcaaatattgatcgatcatatactgatatg
gacgaaagtatttttgaaaaacgtaaagctgaagagcaagaacgttttgataaattatta
gctatgcgcggtacagaaaatgcctataaattacaccgtgaacttggtgaaattatgaca
gcaaatgtaactgttgttcgtgaaaatgaaaaactgttagaaacagataaaaagattgtt
gaattgatgaaacgttatgaagatattgatatggaagatactcaaacttggagtaaccaa
gcggtattctttacccgtcaactatggaacatgttagtacttgcacgtgttattacgatt
ggtgcatataaccgtaacgaatcacgcggtgcccattataaaccagaattcccagagcgt
aatgatgaagagtggttaaaaacgacaatggcctcattccaaggcgcatttgaaaaacca
cagtttacttatgatgacgtcgatgtgagtttaataccacctcgtaaacgtgattacaca
agtaagtctaaagggggtaaaaaataa

DBGET integrated database retrieval system