KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_1117Help
Entry
SAAV_1117         CDS       T01124                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
sad00020  Citrate cycle (TCA cycle)
sad00190  Oxidative phosphorylation
sad00650  Butanoate metabolism
sad01100  Metabolic pathways
sad01110  Biosynthesis of secondary metabolites
sad01120  Microbial metabolism in diverse environments
sad01130  Biosynthesis of antibiotics
sad01200  Carbon metabolism
Module
sad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAAV_1117 (sdhB)
   00650 Butanoate metabolism
    SAAV_1117 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAAV_1117 (sdhB)
Enzymes [BR:sad01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAAV_1117 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SAAV_1117 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_9 Fer4_10 Fer4_17 Fer4_2 Fer4_16 Fer4_15 Fer4 Fer4_13 Fer4_21 Fer4_6 Fer4_4 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ACY11025
LinkDB All DBs
Position
1142500..1143315
Genome map
AA seq 271 aa AA seqDB search
MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaatcagtgaaaaacactccacaacatgaaacacaatctaaaccgaaacaa
aaaacagtaaaattaattattaaacgacaagatacaagtgattctaagccttatgaagaa
acatttgaaattccatatcgtgaaaatttaaacgtcattgcttgtttaatggaaattaga
cgtaacccagttaatattaaaggtgaaaaaacaacacctgttgtctgggatatgaactgc
ttagaagaagtatgtggagcatgttctatggttatcaatggtcgtgcaagacaatcttgt
tctgcgattgttgatcaattagaacaacctattcgtttagagccaatgaatactttccca
gttatccgtgacttacaagttgatcgttctagaatgttcgataacttaaaacgtatgaaa
gcatggatcccaattgatggaacgtatgatttaggtccgggaccacgtatgccagagaaa
aaacgtcaaacagcttatgaattatctaaatgtatgacatgtggtgtatgtttagaggtt
tgtcctaatgttactgaaaataataaattcgttggtgcacaagcaatctcgcaagttcgt
ttgtttaatttgcacccaacaggatctatgactaaagatgaacgtttaaatgcattaatg
ggtactggtggcttacagcagtgtggtaattcacaaaactgtgttaatgcttgccctaaa
ggtattccattaacaacatccattgcagcaatgaacagagaaacaacattccacatgttt
aaatcattctttggttcagaccatgaagtagaataa

DBGET integrated database retrieval system