KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0127Help
Entry
NWMN_0127         CDS       T00557                                 

Gene name
argJ
Definition
(GenBank) arginine biosynthesis bifunctional protein
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00220  Arginine biosynthesis
sae01100  Metabolic pathways
sae01110  Biosynthesis of secondary metabolites
sae01130  Biosynthesis of antibiotics
sae01210  2-Oxocarboxylic acid metabolism
sae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    NWMN_0127 (argJ)
Enzymes [BR:sae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     NWMN_0127 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     NWMN_0127 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: BAF66399
UniProt: A0A0H3KDI2
LinkDB All DBs
Position
complement(158711..159952)
Genome map
AA seq 413 aa AA seqDB search
MKHQETTSQQYNFSIIKHGDISTPQGFTAGGMHIGLRANKKDFGWIYSSSLASAAAVYTL
NQFKAAPLIVTEDTLQKSKGKLQALVVNSANANSCTGQQGIDDARQTQTWVAQQLQIPSE
HVAVASTGVIGEYLPMDKIKTGTEHIKDANFATPGAFNEAILTTDTCTKHIAVSLKIDGK
TVTIGGSTKGSGMIHPNMATMLAFITTDASIESNTLHQLLKSSTDHTFNMITVDGDTSTN
DMVLVMANHQVEHQILSQDHPQWETFVDAFNFVCTFLAKAIARDGEGATKLISVNVSGAK
SISDARKIGKTIVSSNLVKSAIFGEDANFGRIITAIGYSGCEIDPNCTYVQLNQIPVVDK
GMAVLFDEQAMSNTLTHENVTIDVQLGLGNAAATAYGCDLSYDYVRINASYRT
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcaagaaacgacatcacaacaatataacttttcaattattaaacatggcgat
atcagtacacctcaaggcttcacggctggtggtatgcacatcggtttacgcgctaacaaa
aaagactttgggtggatttactcatcgtctttggcaagtgcagctgccgtatatacttta
aatcagtttaaagctgcaccacttattgtcactgaagacactttacaaaagtctaaagga
aaattacaagcacttgttgttaattcagctaatgcaaattcttgtaccggtcaacaaggc
atagatgatgcacgacaaacacaaacatgggttgctcaacaacttcaaataccatctgag
catgttgctgttgcttcaactggggtcattggtgaatatttgcctatggataaaattaag
actgggaccgaacatattaaggatgctaattttgcaacgccaggtgcgtttaacgaggca
attttaacaactgatacctgtacaaaacatatcgctgtatcactaaaaatcgatggtaaa
accgttacaattggtggtagcaccaaaggttcaggtatgattcacccaaatatggctacc
atgcttgcttttataacaaccgatgcatcgattgaatcgaatacacttcatcaattatta
aaatcttcgactgaccatacatttaatatgattactgttgatggcgatacaagtacaaat
gacatggtattagtcatggcaaatcaccaagttgaacaccaaatacttagtcaagaccat
ccacaatgggaaacatttgttgatgcattcaattttgtctgtacatttttagctaaagct
atagccagagatggcgaaggcgcaacaaagttaatcagcgtcaatgtgtcaggcgctaaa
tcaatatcagatgcaagaaaaatcggtaaaactatcgtaagttcaaatctagtaaaatca
gctatttttggcgaagatgccaattttggtcgaatcattacagctattggctacagcgga
tgtgaaattgatcctaactgcacatatgttcaactgaaccaaatacctgtcgttgataaa
ggtatggctgtactatttgatgagcaagctatgtcgaatacattaactcatgaaaatgtc
acaattgacgttcagcttggtttaggtaacgctgcagcgactgcatacggttgtgattta
tcctatgattatgtgcgtatcaacgcatcatatcgaacataa

DBGET integrated database retrieval system