KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1975Help
Entry
NWMN_1975         CDS       T00557                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00473  D-Alanine metabolism
sae01100  Metabolic pathways
sae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sae00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NWMN_1975 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NWMN_1975 (alr)
Enzymes [BR:sae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NWMN_1975 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sae01011]
 Precursor biosynthesis
  Racemase
   NWMN_1975 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAF68247
UniProt: A6QIR5
LinkDB All DBs
Structure
PDB: 

Position
complement(2193212..2194360)
Genome map
AA seq 382 aa AA seqDB search
MSDKYYRSAYMNVDLNAVASNFKVFSTLHPNKTVMAVVKANAYGLGSVKVARHLMENGAT
FFAVATLDEAIELRMHGITAKILVLGVLPAKDIDKAIQHRVALTVPSKQWLKEAIKNISG
EQEKKLWLHIKLDTGMGRLGIKDTKTYQEVIEIIQQYEQLVFEGVFTHFACADEPGDMTT
EQYQRFKDMVNEAIKPEYIHCQNSAGSLLMDCQFCNAIRPGISLYGYYPSEYVQQKVKVH
LKPSVQLIANVVQTKTLQAGESVSYGATYTATDPTTIALLPIGYADGYLRIMQGSFVNVN
GHQCEVIGRVCMDQTIVKVPDQVKAGDSVILIDNHRESPQSVEVVAEKQHTINYEVLCNL
SRRLPRIYHDGDQRFVTNELLK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcggataaatattatagatctgcgtatatgaatgtagatttaaacgctgttgcatca
aatttcaaagtattcagtacattgcatccaaataaaacagtgatggctgtcgttaaagcc
aatgcctatggactaggtagtgttaaagtagcacgtcatttaatggaaaatggcgccaca
ttttttgctgtagcaacgttagatgaagcgatagaacttagaatgcatgggattactgct
aaaattttagtcttaggtgtgttaccagctaaagatattgataaagcgatacaacaccga
gttgccttaacggttccgtctaaacagtggttgaaagaagcaattaaaaacatttctggt
gagcaagagaaaaagttatggttgcacattaaattagatacaggaatgggacgtttaggt
attaaagatactaaaacgtatcaagaagtgattgaaatcattcaacaatatgagcaactt
gtatttgaaggcgtgtttacacactttgcctgtgctgacgaaccaggagatatgacaact
gaacaatatcaacgttttaaagatatggtcaatgaagcaattaaacctgaatatatacat
tgtcagaactcagcaggctctctattaatggattgccaattctgtaatgcaataagacca
ggaatttccctttatggatattatccatcagagtatgtacagcaaaaagttaaagtacac
cttaaaccaagtgtgcaattaattgctaatgtagttcaaacaaagacgctacaagcgggt
gagtctgtaagttatggtgcaacttatacagctactgacccaactacaatagcattgtta
cctattggatatgcagatggctatttacgcataatgcaaggtagctttgtaaatgtaaat
ggtcatcaatgcgaagttattggtcgcgtatgtatggatcagacaattgttaaagtgcca
gatcaagttaaagctggagattcggtgattttaatagataatcatagagaaagtccacag
tcggtagaggtggtagctgaaaagcaacatactattaattatgaagtgctttgtaacttg
tcgagacgtttgccgcgaatctatcatgatggtgatcaacgttttgtaacaaatgaattg
ttaaaataa

DBGET integrated database retrieval system