KEGG   Sulfurihydrogenibium azorense: SULAZ_1192Help
Entry
SULAZ_1192        CDS       T00876                                 

Definition
(GenBank) D-alanine--D-alanine ligase B (D-alanylalanine synthetaseB) (D-Ala-D-Ala ligase B)
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00473  D-Alanine metabolism
saf00550  Peptidoglycan biosynthesis
saf01100  Metabolic pathways
saf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:saf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SULAZ_1192
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SULAZ_1192
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SULAZ_1192
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saf01011]
    SULAZ_1192
Enzymes [BR:saf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SULAZ_1192
Peptidoglycan biosynthesis and degradation proteins [BR:saf01011]
 Precursor biosynthesis
  Amino acid ligase
   SULAZ_1192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 GARS_A ATP-grasp_3 RimK ATP-grasp_4 ATP-grasp ATPgrasp_ST TTL Synapsin_C
Motif
Other DBs
NCBI-ProteinID: ACN99070
UniProt: C1DVM6
LinkDB All DBs
Position
complement(1101044..1101955)
Genome map
AA seq 303 aa AA seqDB search
MSKKIALLYGGYSREREISIKSGKAVEGALQRLGYTYKVFDPVEREKFLEEIVDYKPDLA
FIALHGKGGEDGTIQSLLEFLGIPYTGSDPKTSMICMDKVLTKMYLEKFNINTPKWSFFL
NIEDALSFYPEFPVVVKAPNEGSSIGVYIVNNQDEYKKAVEDVFKLDEKVLVEQFIKGRE
LTVGILDDEVFDIVEVVVEEGFYDYQNKYITGKTKYICPAQLPPEVYKTVQDIGYKTYKS
LNCKGQARVDIILDYSLTPYVLEVNTVPGMTEFSLLPKAAAVKGISFDQLVDRIIKSGLK
NDK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaaaagatagctcttctttacggaggatattcaagagaaagagaaatatctata
aaaagtggaaaagccgttgaaggagctctacaaaggttaggatacacttataaagtattt
gaccctgttgaaagagaaaaattcttagaagaaattgtagattataaacctgatttagcc
tttatagcccttcacggaaaagggggagaagacggaactatccagtctttattagagttt
ttaggtatcccctacacaggctcagacccaaaaacaagtatgatttgtatggataaggta
ctaacaaaaatgtatttagaaaagtttaatattaacacacctaaatggagtttcttttta
aatatagaagatgcattatctttttaccctgaatttccagttgttgtaaaagccccaaat
gaaggctcttccataggtgtatacatcgtaaacaaccaagatgagtataaaaaagccgtt
gaagatgtttttaagttggacgaaaaagtattagtagaacagtttataaaaggaagagaa
cttacagttggaatacttgacgatgaagtgtttgatatagtggaagtagttgtagaagaa
ggattttatgactatcaaaataaatacataacaggaaaaacaaagtatatctgtcctgca
cagctcccacctgaagtttacaaaactgtgcaagatataggatataaaacatacaaatct
ttaaactgtaaaggacaagcaagagttgatataatattagattatagtttaacgccatac
gttttagaagttaacactgttccagggatgacggagtttagtttactaccaaaagcagct
gctgtaaaaggaatttcttttgaccaattggtagacagaataataaaaagtggtttgaaa
aatgataaataa

DBGET integrated database retrieval system