KEGG   Sulfurihydrogenibium azorense: SULAZ_1389Help
Entry
SULAZ_1389        CDS       T00876                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00471  D-Glutamine and D-glutamate metabolism
saf00550  Peptidoglycan biosynthesis
saf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SULAZ_1389 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SULAZ_1389 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saf01011]
    SULAZ_1389 (murD)
Enzymes [BR:saf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     SULAZ_1389 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:saf01011]
 Precursor biosynthesis
  Amino acid ligase
   SULAZ_1389 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ACN98245
UniProt: C1DW69
LinkDB All DBs
Position
1295996..1297270
Genome map
AA seq 424 aa AA seqDB search
MILIYGKGKTGTAVKNFLDKKGIKNLIIDDEDRLPDINPQLIIVSPGIPFYHRIYKFAKK
NKIPIISDVEYGYRFFKGDVIGITGTDGKTTTTTLVYEIFKNVSGKSVFVGGNYGVPFIE
TAGKNDVAILELSSFQLYSTKTFKPKIAVILNISKDHLDWHKKMKHYILSKFKIFKNQTE
EDYLILNYDDNCLKQIKAKSQIYYFSLNQLPQDKKGIYLKNIEKSGEYILTLQDKEKIDI
KVKTSLVGLHNLQNIMASLVVSYLYGLDLDKVLKVIQEFKPLSHRIEFVSSINGVSFYND
SKATTVQAVEKAIDSFDKNVVLILGGINKGGDFSVLKDKLKQKVKKAIIIGRDKNQIKSM
IEEYTQVELADSLEEAVIKSYNTAEKGDTVILSPGCASFDMFKSYADRGNQFINIVKNLE
NQNG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatactaatctacggaaaagggaaaactggaacagctgttaaaaattttttagataaa
aaaggtataaaaaatctaataatagatgatgaagacagattaccagatataaatccccag
ctgataatagtatctcccggcattcctttttatcacaggatatataagtttgcaaagaaa
aataaaatcccaatcatatcagatgtagagtatgggtatagattttttaaaggagatgtt
attggaataacaggaacagatggtaaaaccactaccactacactcgtgtatgagattttt
aaaaatgtatcaggtaagagtgtgtttgtaggtggaaactatggagtgccttttatagaa
acagccggcaaaaatgatgttgcaattttggagttgtcttcttttcaactttactctaca
aaaacatttaagccaaaaattgccgttatattaaacatatcaaaagaccaccttgactgg
cataaaaagatgaaacattacattctttcaaaatttaaaatctttaaaaatcaaactgaa
gaagactaccttattttaaactacgatgataactgtttaaaacaaatcaaagcaaaaagc
cagatttactacttttcattaaatcagcttccacaggataaaaaaggaatataccttaaa
aatattgaaaaatcgggagagtatatattaacacttcaagacaaagaaaagatagatatc
aaagtaaaaacttcgttagtaggactacataaccttcaaaatataatggcatctttagtt
gtgtcttacctttatggactggatttagataaggttttaaaagtaattcaagagtttaaa
cccctatcccatagaatagagtttgtaagcagtataaacggtgtttcattttacaatgac
tcaaaagcaacaactgttcaagcagttgaaaaggctatagatagttttgataaaaacgta
gtactcatattaggaggaataaataaaggaggagacttttctgttttaaaagataaatta
aaacaaaaagttaaaaaagccataataataggaagagacaaaaaccagataaaaagtatg
atagaagagtacacgcaagttgagcttgcagacagtttagaggaagctgtaataaaaagc
tacaatactgccgaaaagggagacactgtaatactgtctccggggtgtgcaagttttgat
atgtttaaaagttatgctgacagaggaaaccagtttataaacattgtaaaaaatttggaa
aatcaaaatggttag

DBGET integrated database retrieval system