KEGG   Sulfurihydrogenibium azorense: SULAZ_1496Help
Entry
SULAZ_1496        CDS       T00876                                 

Definition
(GenBank) pyruvate carboxylase (Pyruvic carboxylase) (PYC)
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00020  Citrate cycle (TCA cycle)
saf00620  Pyruvate metabolism
saf00720  Carbon fixation pathways in prokaryotes
saf01100  Metabolic pathways
saf01120  Microbial metabolism in diverse environments
saf01200  Carbon metabolism
saf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SULAZ_1496
   00620 Pyruvate metabolism
    SULAZ_1496
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULAZ_1496
Enzymes [BR:saf01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     SULAZ_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 GARS_A Oxidored_nitro AbiGii_2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACN98143
UniProt: C1DWH6
LinkDB All DBs
Position
complement(1396541..1397989)
Genome map
AA seq 482 aa AA seqDB search
MSKLKTFTKEIKKVLIANRGEIATRIIRACKELDIKTVAIYSEADAKSIYVKKADEAYLI
PGDPIQAYLNYFRIVDLAKQTKCDAIHSGYGFLSENPEFAEYCWKQGIVFIGPHPDHIAL
FGDKMAAKKKMRELGVPVLPGSDEPISDIKKAKKIADEIGYPVILKAAFGGGGRGMRIVR
EESEFEDLFKSAFNEAKKFFGRGDVFIEKYVENPRHIEIQIMADKYGNVVHLGERDCSIQ
RRHQKVVEIARSPTLNEDVKRELYRTSVKAMFKVGYENVGTIEYLVDEKDNFYFIEMNTR
LQVEHTVTEMVTGIDIVQQMIKIAQGEKLGFLQEDITMRGYAIEFRVNAEDPKRNFAPSV
GAITSYHSPGGPGVRVDAAVYKDYVIPPYYDSMIAKLSVWALTWDQVVNRARRALDEFIV
RGVPTNLPLLRAIVRDEDFIKGKFTTRYIEEKLPTFNLEDKTADLEDLVAAIAGAIAAYH
KI
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaactaaaaacctttacaaaagagataaagaaagttttaattgcaaacagagga
gagatagctaccagaataataagagcttgtaaagagcttgatattaaaactgtagctatt
tactctgaagcagacgcaaaaagtatatacgttaaaaaagctgatgaggcatatttaatt
cctggtgatcctatccaagcatacttaaactactttagaatagttgaccttgcaaaacaa
acaaaatgtgatgctatacattccggttatggatttttatcagaaaaccctgagtttgca
gagtactgctggaaacaagggattgtgtttattggaccacatccggatcacatagccctt
tttggcgataaaatggcagccaagaaaaagatgagagaacttggagtgcctgttttacca
ggaagtgatgagcctatctcagacattaaaaaagcaaaaaagatagcagatgagataggt
tatccagtaatactgaaggctgcctttggtggtggcggaagagggatgagaatagttaga
gaagaatcagaatttgaagacctgtttaaatcagcttttaatgaagcaaagaagtttttc
ggaagaggagacgtatttatagagaagtacgttgaaaatccaagacatatagaaatacag
ataatggcagataagtacggaaacgtagtccatttaggagagagagattgttcaatccaa
agaagacaccaaaaagtagttgagatagcaaggtctccaacgttaaacgaagatgttaaa
agagagttgtatagaacttcagttaaagcaatgtttaaagtaggatatgaaaatgttgga
acgatagagtaccttgttgatgaaaaagataacttttactttatagagatgaacacaaga
cttcaagttgagcatactgttacagagatggttacaggtatagatatagtccagcagatg
ataaagatagcccaaggagaaaagttaggttttctacaagaagatattacaatgcgtgga
tacgcaatagagtttagagtcaacgcagaagaccctaaaagaaactttgctccatcagta
ggagctataacttcttaccactctccaggaggacccggtgttagagtagatgcagctgta
tataaagattatgtaataccgccttactacgactctatgatagcaaaactatcagtctgg
gctttaacttgggaccaagttgtaaacagggcaagaagagctttagatgagtttatagtt
agaggagtccctacaaatctacctctccttagggcaatagtaagagacgaagattttata
aagggtaagtttactacaagatatattgaagaaaaacttcctacatttaacttagaagat
aaaacagctgacttagaagacttagtagctgctatagctggagcaatagccgcataccat
aaaatttaa

DBGET integrated database retrieval system