KEGG   Sulfurihydrogenibium azorense: SULAZ_1581Help
Entry
SULAZ_1581        CDS       T00876                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00471  D-Glutamine and D-glutamate metabolism
saf00550  Peptidoglycan biosynthesis
saf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SULAZ_1581 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SULAZ_1581 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saf01011]
    SULAZ_1581 (murC)
Enzymes [BR:saf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     SULAZ_1581 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:saf01011]
 Precursor biosynthesis
  Amino acid ligase
   SULAZ_1581 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C F420_oxidored CCM2_C LUD_dom
Motif
Other DBs
NCBI-ProteinID: ACN99599
UniProt: C1DWQ8
LinkDB All DBs
Position
complement(1474435..1475799)
Genome map
AA seq 454 aa AA seqDB search
MFRGKIRRIHFIGIGGSGMNGIAELLLNQGYTISGSDLKESYTTQRLRELGAKVYIGHSE
DNVKDVDVVVYSSAVKPDNPELKKARELGIPTIPRGEMLAELMRFKYGIAIAGSHGKTTT
TSMVGTVLGKTGFDPTVVIGGKLEAYGSNAKLGRGEFLVAESDESDGSFLKLTPTIVSIN
NIDLEHLGFYKDLEDIKNAFVEFANKVPFYGFVVANIDDENVKSIIPRIERKIIKFGLSK
DADIRGYDLKLVNGRYKFKINDFGEIHLSVPGIHNVYNALATISICNELGVPFCVIKESL
ENFKNAKRRFEIKYSDGILVIDDYAHHPTEIKATLSAARDMYGQNRIISVFQPHRYSRVY
SLFDEFVESFDIPDIVIITDIYSAGENPIEGVSGQLLADKIRQRRNNVFYVKDVNEAESL
LKSIIKNGDVVLTMGAGNITQLSDNLSKYLEERR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
ttgtttagaggtaaaatcagaaggatccactttataggtatcggtggttctggtatgaat
ggaattgctgagctccttttaaaccaaggttatacaatttcaggaagtgatttaaaagag
tcttacacaacacaaaggttaagagagcttggagcaaaagtatacataggacatagtgaa
gataatgttaaagatgttgatgttgttgtttactcttctgctgtaaaaccagacaatcca
gagttaaaaaaggcaagggagctgggtattcctactattccaaggggagagatgcttgca
gagttaatgagatttaagtacggtattgctatagcaggctcccatgggaagactactaca
acgtcaatggtaggaacagttttaggtaaaacaggttttgacccaacggtagttataggc
ggaaagttagaggcatacggaagtaatgcaaagttagggagaggagagtttttagtagca
gagtctgacgaaagtgatgggtcatttttaaaacttactcctacaattgtttcaataaac
aacatagatttagagcatcttggattttataaagatttggaagatataaaaaatgcattt
gttgaatttgccaacaaagtacctttttacgggtttgtagttgctaatattgatgatgaa
aatgtaaaaagtataattccaagaatagagagaaaaattattaaatttggactttctaaa
gatgcagatattagagggtacgacttaaagcttgtaaacggaaggtataagtttaaaatt
aacgattttggagagatacatctatcagttccgggtattcataacgtatacaacgctctt
gctactatttctatatgcaacgagcttggagttcctttctgtgttataaaagagtcttta
gaaaattttaaaaacgcaaaaagaaggtttgagattaaatacagtgatggaattttagta
atagatgactatgcacaccatcctaccgagataaaagcaaccctttcagctgccagagat
atgtatggtcaaaaccgtataatatccgtttttcaaccccatagatacagtagggtttac
tctttgtttgacgaatttgtagaatcttttgatatacctgatattgttatcataacagat
atatactcagcaggagaaaaccctatagaaggtgtatcaggacagttattagcagacaag
ataagacaacgaaggaataacgtcttttacgtaaaagatgtaaacgaggctgagagtttg
ttaaaaagtataataaaaaacggtgatgttgttttaacaatgggagctggaaacataaca
cagctgagtgataatttatcaaagtacttagaggaaagacgttaa

DBGET integrated database retrieval system