KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0708Help
Entry
SAG0708           CDS       T00091                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
sag00500  Starch and sucrose metabolism
sag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAG0708
Enzymes [BR:sag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SAG0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 1013512
NCBI-ProteinID: NP_687723
UniProt: Q8E0M2
LinkDB All DBs
Position
700987..702453
Genome map
AA seq 488 aa AA seqDB search
MTNELIMQAFEWYLPSDGNHWKKLEESISDLKKLGISKIWLPPAFKGTSSDDVGYGVYDL
FDLGEFDQNGTIRTKYGRKEEYLKLIKSLKANGIKPFADIVLNHKANGDHKEKFQVIKVN
PENRQEALSEPYEIEGWTGFDFPGRQGEYNDFKWHWYHFTGLDYDAKNNETDIFMIVGDN
KGWADDDLIDDENGNFDYLMYNDIDFKHPEVIKNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFINDIRTKIKPDLEVFGEYWKSDQTSMKDYLEATQFQFSLVDVTLHMNFFDASH
QNRDFDMRTIFDDSLVIDNPEYAVTFVENHDTQSGQALESRVEDWFKPLAYGLILLRQQG
TPCLFYGDYYGIQGEFGQPSFKEVIDKMAELRQNYVFGKQVDYFTHSNCIGWTCLGDEEH
NSCLAVVLTNGDQGWKHMEVGEIYAGKTFVDYLGNCEQEVVIGDDGWGDFLVESASISAW
VPKIEEAN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaattgataatgcaagcttttgagtggtatttacctagtgatgggaatcac
tggaagaaattagaggagtctatatcagaccttaaaaaacttggaattagtaaaatctgg
ttaccaccagcatttaagggaactagcagtgatgatgtaggatatggtgtttatgatctc
tttgatttaggagaatttgaccagaatggaacaattagaacaaaatatggtaggaaagaa
gagtatctaaagcttattaagtcgttaaaggcaaatggcattaaaccgtttgcagatatc
gttcttaaccataaagccaatggtgatcataaagaaaaatttcaagtcatcaaagtcaat
cctgaaaatcgtcaagaagcattaagtgaaccctatgagattgaaggatggacgggattt
gatttcccaggtagacagggtgagtacaatgattttaaatggcactggtaccactttact
ggtttagattacgatgctaaaaataatgaaacagacatctttatgattgtaggcgataat
aaaggttgggcagacgatgatttgattgatgatgaaaatggtaatttcgattatctcatg
tacaatgacattgattttaagcatcctgaagttataaaaaacttacaagattgggctaag
tggtttattgaaactacaggcattgaaggttttcgtttggatgctgtgaaacatatcgat
tcttactttattcaaactttcattaatgatattcgtacaaaaataaaacccgatttagag
gtctttggcgaatattggaaatctgaccaaacatcaatgaaggactatttagaggcaaca
caatttcaattttctcttgttgatgttaccttacatatgaatttttttgatgccagtcac
caaaaccgtgattttgatatgcgaacaatttttgatgatagtcttgttattgataatcct
gagtatgctgttacattcgtagaaaatcatgatacgcaaagtggacaagctctagaaagt
agagtggaagattggtttaaacctttagcttatggcttgatacttttacgccaacaaggg
actccatgtcttttttatggtgattactatggcattcaaggagaatttggtcaaccatcc
tttaaagaggttattgataaaatggctgagctacgccaaaactatgtatttggcaaacaa
gtcgattattttacgcattcaaattgtattggttggacttgtcttggggatgaggaacat
aattcttgtttagctgtggtcctaacaaatggtgatcagggatggaaacatatggaagta
ggggaaatttatgcaggcaaaacgtttgttgattatttaggtaattgtgaacaagaggtt
gttataggagatgatggttggggtgattttttagttgaatctgcgtctatctcggcttgg
gttcctaaaatagaggaagctaactga

DBGET integrated database retrieval system