KEGG   Streptococcus agalactiae 2603 (serotype V): SAG1078Help
Entry
SAG1078           CDS       T00091                                 

Gene name
tdk
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
sag00240  Pyrimidine metabolism
sag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sag00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAG1078 (tdk)
Enzymes [BR:sag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SAG1078 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30 ATPase_2
Motif
Other DBs
NCBI-GeneID: 1013882
NCBI-ProteinID: NP_688087
UniProt: Q8DZM3
LinkDB All DBs
Position
complement(1087409..1087978)
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDEFGVVSSRIGMRREAV
PISDDMDIFSYIQNLPQKPYCVLIDECQFLSKKNVYDLARVVDDLDVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPDI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatgggacaatgaattctggtaaaaccattgaaatttta
aaagttgctcataactatgaagaacaaggaaaacctgtggttattatgacaagcgccttg
gacactcgagatgaatttggagtcgtttcaagtcgtattggaatgcgtcgtgaagcagtt
ccaatttcagatgatatggacattttctcctatattcagaatttaccacaaaagccttat
tgtgttttaattgatgaatgtcaatttttgagtaagaaaaacgtctacgatttagctaga
gtagtagatgacttagatgtaccagtcatggcttttggtttgaaaaatgatttccaaaac
aatctttttgaaggttcaaaacatttgctattattggccgataagattgatgaaatcaaa
acaatttgccaatactgtagtaagaaagcaaccatggttttaaggacagaaaacggaaaa
cctgtctatgaaggtgatcagatacaaattggtggtaatgaaacatatatcccagtttgt
cgaaaacattattttaatccagatatttaa

DBGET integrated database retrieval system