KEGG   Simiduia agarivorans: M5M_05160Help
Entry
M5M_05160         CDS       T02281                                 

Definition
(GenBank) PASTA sensor-containing serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
saga  Simiduia agarivorans
Brite
KEGG Orthology (KO) [BR:saga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:saga01001]
    M5M_05160
Enzymes [BR:saga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     M5M_05160
Protein kinases [BR:saga01001]
 Serine/threonine kinases: Other
  Bacterial family
   M5M_05160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo Haspin_kinase FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AFU98237
UniProt: K4KWE9
LinkDB All DBs
Position
1144238..1145542
Genome map
AA seq 434 aa AA seqDB search
MLPFTMHPLIKTLPAKTIQPIGSVVRGCLLLPHAIGDKTLAKDWLARAHGAWLATLLVVA
YLLFANQWLAGVLADWRYPPPKESLGKRIVQVFNPNVSHKHPLRDSQQRLYARYGYWSLG
IPVLLLLGALPGAVRRQALNASGSDQDLASTQVRSGPAIPTQVFQPKPELGLVGEGQRYR
LDALLASGGAGVVYQGFDTRLQRAVAIKKLLGHLEQDPVMLARFKTEALSLARLNHPHIV
QVFDLFEDRGNQWLVMEWMTGGSLADVIHEHKKLPAARAISIARQVADGLAQAHAEGIIH
RDIKPDNILFDGRGNAKISDFGIARTGNNNHQTQAGLVIGSPGYMSPEQAAGEAASSASD
VYALGVTVYEMLAGELPFTGETTQVLLKHISRPPPLLHTLMPELPGPLCALVDRMLAKDP
TQRPTDIAQSLRTL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttgctgccgtttaccatgcacccgttgataaaaacattgcccgcgaaaaccatccagccc
atcggttcggtggtgcggggctgcctgttgctaccccacgccatcggcgacaagacactg
gccaaagactggctcgcgcgcgcccatggcgcctggctggccaccttgctggttgtcgcc
tatttgctgttcgccaaccaatggcttgccggggtactggcggactggcgctacccgccg
cccaaggaatccctgggcaagcgtatcgtccaggtgtttaaccctaatgtcagtcacaag
catcccttgcgggattcccaacagcgtctctatgcgcgttacggctactggagcctgggc
attccggtactgctactgcttggcgcactgccgggcgccgtgcgccggcaggcgttgaat
gcctctggctcagaccaggatcttgccagcactcaggtgcgttcagggccagcgatacct
acacaggtgtttcagccaaagcccgagctcggcctggtaggcgaaggccaacgttatcgg
ctggacgctttgctggcatcgggcggtgcgggtgtcgtttaccagggttttgatacccgc
ttgcagcgcgcggtggcaattaagaaactactgggccacctcgagcaggatccggtcatg
ctcgcccgcttcaagaccgaagcgctgagtttggcccgactcaaccatcctcatatcgtt
caggtgttcgatctgtttgaggacaggggaaatcaatggttggtgatggaatggatgacc
ggtggcagtctcgccgacgtgatccatgagcataaaaagctgcccgcggcgcgcgcaatc
agcattgcccggcaggtagcggatggtctcgctcaggcccatgccgagggtattatccat
cgcgacatcaaacccgataacatcctctttgatggccggggcaacgccaaaatctcggac
tttggcatcgcccgcaccggcaacaataaccaccagacccaggccggtctggtcataggc
tccccgggttacatgagcccggagcaggctgcaggcgaagcggccagctcagccagcgat
gtctatgcgctgggcgtcaccgtttacgaaatgctggccggcgagttgccgttcactggg
gaaaccacgcaggtgttgctcaaacacatcagccggccaccaccactgcttcacacgcta
atgcccgaactgcccgggccgctgtgcgcgctggtcgatcggatgttagccaaagacccc
acgcaacggccaaccgacatcgcccaaagcctgcgcacgctgtaa

DBGET integrated database retrieval system