KEGG   Simiduia agarivorans: M5M_09485Help
Entry
M5M_09485         CDS       T02281                                 

Gene name
pbp1b
Definition
(GenBank) murein polymerase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
saga  Simiduia agarivorans
Pathway
saga00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:saga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M5M_09485 (pbp1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:saga01003]
    M5M_09485 (pbp1b)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saga01011]
    M5M_09485 (pbp1b)
Enzymes [BR:saga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     M5M_09485 (pbp1b)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     M5M_09485 (pbp1b)
Glycosyltransferases [BR:saga01003]
 Polysaccharide
  Bacterial polysaccharide
   M5M_09485 (pbp1b)
Peptidoglycan biosynthesis and degradation proteins [BR:saga01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   M5M_09485 (pbp1b)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AFU99082
UniProt: H8YHZ1
LinkDB All DBs
Position
complement(2095609..2097843)
Genome map
AA seq 744 aa AA seqDB search
MLALSALLGLVAVVLLDIQVRSKFEGRKWALPAHVYARPFEVYEGMPLAPARLEAQLKTL
GYQPVATLSGPGQFERRRLGAQTVFAINSRGFEFWDQAEPPARWDLTFSGDQITRLTGGN
LLRLEPEKIGGIYPAHQEDRQLVRLQDIPPLLGETLLAVEDKHFLDHQGVSIRAIGRALW
ANVKAGGVAQGGSTITQQLVKNFYLTNERSLSRKGMEAIMALLLEVHYSKAEILETYLNE
VYLGQQGAKSINGFGLASQHYFRRPLNELGIDQIALLVGLVKGASYYNPWRSPARAKDRR
DLVLGIMHESGLINDRQYKIESQRPLRVAAPNQEPITRYANFLDLVKRQLRRDYSADDLQ
SEGLRVFTTLETGVQNQVETTLASSLKRVERDRGLAAGSLQGAVVVARVGSAEVLALAGD
RTPSLAGFNRALDARRPIGSLAKPAVYLAAFEQSPAYQLATRISDEPVRVAGPDGEWAPT
NYDRESHGQVPLYQALAQSYNQATARLGMQLGLNQVARTLERMGGEARVPRVPAMLLGAV
DMSPLAVTEQYHTLAADGFYSPLRAILEVTDQRGKPLSRYPLAVEQRFDAQSVFLLHYAL
RSVMREGTGKAAYRQLPASLDVAGKTGTTNDQRDSWFAGFSAEHVATVWVGRDDNGTTPL
TGSIGALPIWSEIVAGLDTRGLDAPPPAGVTYYWTDERSGQASGENCRFARLIPYSYGQA
PSGKADCEWVQNPLMHWWKKLWQD
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
ttgctggcgttgtcggcactgctggggctggtggctgtggtgctgctggacatccaggtg
cgcagcaaatttgagggccgtaaatgggccttgcccgcgcatgtgtacgcgcgcccgttc
gaagtttacgagggtatgccactcgcgcccgccagacttgaagctcagctcaaaacgctg
ggttatcagccggtggcgaccttgtccggccctgggcaattcgagcgtcggcgcctgggc
gcgcagacggtattcgccatcaacagccgcggttttgaattctgggatcaggccgagccg
ccggcgcgttgggatctgactttcagcggagaccaaataacgcggttgaccggtggcaac
ctgttgcgactggagcctgaaaaaatcggtggcatttacccggcgcatcaggaagaccgc
cagttggtgcgtttgcaggacattccgcctttgctgggcgaaacactgttagcggttgag
gataaacactttctcgatcatcagggcgtgtcgatccgcgccatcggacgtgcactctgg
gccaatgtcaaagccggtggtgtcgcccagggcggcagtaccatcacccaacagctggtg
aaaaatttctatctcaccaatgaacgcagcctgagccgcaaaggcatggaagcgatcatg
gcgctgctgctggaagtgcattacagcaaggcagaaattctggaaacctacctcaatgaa
gtgtatctggggcagcagggggccaagtccatcaatgggttcgggttggcgtcgcagcat
tatttccgacggccactgaacgaactcggtatcgaccagattgccctcctggtgggcttg
gtgaagggcgccagctactacaacccctggcgttcgccggcgcgcgcgaaagaccggcgc
gacctggtgttgggcatcatgcacgaatcgggtctgatcaatgaccgtcaatacaagatt
gaaagccagcgtccgctgcgggtggcggcgccgaatcaggaaccgataacccgttatgcc
aattttctggacctggtaaaacgccagctcaggcgtgattacagcgcagatgacctgcaa
agcgaaggcttgcgggtatttacgacactcgaaaccggcgtacagaaccaagtggaaaca
acccttgcatcctctctcaaacgggttgagcgggatcgtggtctggccgccggcagcttg
cagggcgcggtagtggtggcgcgtgtcggcagtgccgaagtgttggccctggcgggtgat
cgcacgccctcgctggcgggcttcaatcgcgcgctcgacgcccgccggcccattggctcg
ttggccaagccggctgtctatctggcggcctttgagcagagtccggcgtatcagcttgcc
acccggatcagtgacgagcccgtcagggttgctgggccggacggtgagtgggcgcccact
aattacgaccgtgaaagccatggccaggtaccgctttaccaggcgctggcccagtcctac
aaccaggccaccgcgcgtctggggatgcagttggggctgaatcaggttgcgcgcacattg
gagcgcatggggggcgaggctcgcgttccgcgcgtaccggccatgctgttaggggctgtg
gacatgtcgccgttggcggtaaccgagcagtatcacaccctcgcagccgacgggttttac
tcgccattgcgcgcgatcctggaggtgaccgatcaacgcggcaaaccgctgtcgcgctac
ccgttggcggtggagcagcgctttgatgcgcagtcggtgtttctgctgcactatgcgctc
cggtcggtcatgcgcgaaggtaccggcaaggcggcctatcgccagctaccggcttcgttg
gatgtggcgggtaaaaccggcaccaccaatgatcagcgggacagctggtttgcgggcttc
agcgccgaacacgtggccacggtctgggtcgggcgggacgacaacggcaccacgcccctg
accggctccattggtgccctgccaatctggagcgagattgtggccggcctcgacacccga
ggattggatgcgcccccgccggcgggggtaacctattactggacggacgaaagaagcggc
caggccagcggtgaaaattgccgctttgcccgcctgattccctatagctacggtcaggca
ccgtccggcaaggccgactgtgaatgggtgcagaacccgctgatgcactggtggaaaaag
ctgtggcaagactga

DBGET integrated database retrieval system