KEGG   Simiduia agarivorans: M5M_10155Help
Entry
M5M_10155         CDS       T02281                                 

Definition
(GenBank) serine/threonine kinase protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
saga  Simiduia agarivorans
Brite
KEGG Orthology (KO) [BR:saga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:saga01001]
    M5M_10155
Enzymes [BR:saga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     M5M_10155
Protein kinases [BR:saga01001]
 Serine/threonine kinases: Other
  Bacterial family
   M5M_10155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TPR_2 TPR_8 TPR_1 TPR_19 TPR_12 TPR_16 TPR_11 TPR_14 TPR_17 APH Wzy_C_2 TPR_7 ANAPC3 Kinase-like TPR_MalT Kdo Haspin_kinase TPR_9 TPR_10 RIO1 BTAD Pkinase_fungal TPR_15
Motif
Other DBs
NCBI-ProteinID: AFU99212
UniProt: K4KZ77
LinkDB All DBs
Position
2239191..2241728
Genome map
AA seq 845 aa AA seqDB search
MTEAEIPQTENYTVEAILGKGGMGVVYLAFDKRLNRKVAIKCIRHNRANENWVEAVTEEA
RLLAQINHRNIVHIYDLIDWQGSPALVMEYLQGRTLLDIFRSDELMSGELDLATRLDWLR
QIAEGLACAHAKGIIHRDLKAENIMITDEGTVKIMDFGIARHQAQPLHANIHDSQVLPGE
FIGSPAALSPEQAMGDRLTTASDIFSFGILAYCLLCGHHPFGDPKNADLVLQGIIYRPPM
PVQFLECLGIPDEDAQTLGAEIIACLNKAPGMRPAASALAFTQTIPNKEDYTAMPVPPQN
SRGLALTISAILVTATAGLIWLAGQQPEPRRNVYVALPTFTGTDMAEYITEATPEFLRNG
IIDALLIDDRHAVIQYDNASKLEEPSQLGLASGANEVLKLTFECKKYWCDGRMARYSGPE
WHKTSGDAFSIDLRNGSDSFSAVQWHTVKSGLILNDRHIDNARDPSREYFSLLTEFRKTR
YLSGESIKILIDEILTYPSFTPNYHLLVKVATRNFQINNNSGDLKIALELIESNKAELPT
STYLKLIGQCQSALKFYREAEASAEKLLQFGSVFDARLIEADLAIEQGNYQHALDTYTSL
IDYAPSENGFYGIAYSAYILGDIALTKRALNSALTLNPNSIPANSLLGSLQLSDGEYTSA
IENFNKIVEIIPDEPTLNNLATAYLLSGNRAEAKKQFEKAAQLAPNNPTILYNLGELELL
AGNQNNAQIFFEKAIKGLRSLEQSSDASIAIRALSLLGRTEEAKNVLTTTEKNFSGIPDY
LFSEAIYYTTIGQPDLAQEKIEMLIALGYTKDWFRFPWYGADCNKAINAQNDHLCSAPIN
LEGDE
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggccgaaattcctcaaaccgaaaactacaccgttgaagccatcctgggtaag
ggcggcatgggtgtggtttacctcgcgtttgacaagcgcctcaaccgcaaagtggccatt
aaatgcatccgccacaaccgcgccaatgaaaactgggtggaggcggttaccgaagaagcc
cgcctgctggcgcagatcaatcaccgcaacatagtgcacatttacgacctgatcgactgg
cagggctcacccgcgctggtaatggaatatttgcagggccgcaccctgttggatattttt
cgttcagacgaactcatgagtggcgagctggacctcgccacccggctggactggctgcgg
caaattgccgaaggcctggcctgcgcccacgccaagggcatcattcaccgcgacctgaaa
gccgaaaacatcatgatcaccgacgaaggcacggttaagatcatggacttcggcattgcc
cggcaccaggctcagcccctgcacgccaatattcacgacagccaggtgctgcccggcgaa
ttcatcggcagccccgccgccctctcgcccgaacaggccatgggcgaccggctcaccacc
gccagcgacattttcagcttcggcatcctggcctattgcctgctgtgcggtcatcacccc
ttcggcgacccgaaaaacgccgacctggttctgcaaggcatcatctaccggccgcctatg
ccggtgcagtttctggagtgcttgggcatcccggatgaagatgcgcagacattgggtgcg
gagattattgcttgcttgaataaggcgccggggatgcggccggcggcgagtgctttggca
tttacgcaaacgattccaaataaagaagactacacggcgatgccagtgccgccccagaat
tctcgcggtttggcactcacgatcagcgccatactggttaccgccaccgccggcctgatc
tggctggccgggcaacaaccggaacctcgtcgcaatgtttacgtggccttgcctacattt
acgggaaccgatatggccgaatatattaccgaggccacaccggagtttttgcgcaatggc
attattgatgcgctgcttatagacgaccgtcatgctgttatccaatacgacaatgccagc
aaacttgaagagcccagccaacttggactcgcctctggcgccaatgaggtgcttaaactg
acatttgagtgcaagaagtattggtgtgatggaagaatggcacgctactcggggccggaa
tggcacaaaactagtggcgatgcattttccatagacctgcgaaatggctctgactctttt
tcggcagtgcaatggcataccgttaaatcgggcctgatcctaaacgacagacacattgat
aacgcccgcgatccgtctcgagagtatttcagtcttttgacggaatttaggaaaacccgc
tatctgtcaggcgagtcaataaaaattctcattgacgagatattgacctacccttcattc
acgccaaattatcacttgttagtgaaagtcgcgacacgaaacttccagatcaacaacaat
agtggcgacctcaaaattgcacttgagttaattgagtccaacaaagctgaactgccgact
tcgacctatttgaagttgattggacaatgccaaagcgcactaaaattctatcgagaagca
gaggcgtcagccgaaaaactacttcaattcggatcggtatttgatgcgagattaattgaa
gcagatttagcaatagaacaaggcaactatcagcacgcgctggatacgtacacgtctctt
atagattatgctccttccgaaaatggcttttacggtattgcctacagcgcctacatactc
ggagacattgcgctgacaaaaagagcgcttaatagcgcccttactctcaacccaaatagc
ataccagccaacagcttattaggatcgcttcaattgtccgatggcgaatacacatcggca
atcgaaaatttcaacaagatagttgaaatcatccccgacgaacccaccctgaacaatcta
gccacggcttacctactttctggaaatcgagcagaagcaaaaaagcaatttgaaaaagcc
gcacaactggcgcccaacaaccctacaattttatataatttgggagagctagaactatta
gcaggaaaccagaataacgcgcagattttttttgaaaaagcaataaaaggactcagatca
ctcgaacaaagcagtgatgcaagcattgcaataagagcgctcagcttgctcggaagaaca
gaagaagctaaaaatgtgctaacaaccaccgaaaaaaacttttcaggtattccagactac
ctcttcagcgaagccatctactacacgacaatcgggcagcctgatctcgctcaggaaaaa
attgaaatgctaattgcgctcggctacacaaaagattggtttcgctttccttggtatggc
gctgattgcaacaaagcaatcaacgcacaaaacgatcacctgtgctccgcaccaatcaat
ttggagggcgatgaataa

DBGET integrated database retrieval system