KEGG   Simiduia agarivorans: M5M_17060Help
Entry
M5M_17060         CDS       T02281                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
saga  Simiduia agarivorans
Brite
KEGG Orthology (KO) [BR:saga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    M5M_17060
Enzymes [BR:saga01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     M5M_17060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like Thioredoxin_3 GIDA FAD_binding_2 DAO FAD_oxidored Thi4 NAD_binding_8 AlaDh_PNT_C FAD_binding_3 Lycopene_cycl NAD_binding_7 Glutaredoxin K_oxygenase Thioredoxin_4 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFV00543
UniProt: K4L2W8
LinkDB All DBs
Position
complement(3761019..3762626)
Genome map
AA seq 535 aa AA seqDB search
MISKDILAALSQYTANIATPVAFVLQTGQHTKRDELVTFLNDFASVSEHLSLREQDAGLR
SPVTFTLEVDGEHTGIEFSGIPSGHEFNSLVLAVLHATGTPMKLDESLKAMLARVDEPLH
FEAFISLSCHNCPDVVQALNQFALINPNIRAEMIDGGLFQDVIKARDIQGVPTVYLNGEL
FANGKVDAAQLIEKLLARYPHLADGNNAEQLPLQDVTIIGGGPAGISSAIYSARKGLKVT
LIADRIGGQVKDTMGIENLIGTPKTTGPELSGALMQHLNDYEVTVKEHLKVSAVEKGDIK
TLTLSSGEVIHTKTLIIATGAKWRELGIPGEKENIGNGVAYCPHCDGPFFKGKDVAVIGG
GNSGIEAALDLAGIVKSVTVFEFMPELKADKVLVEKAESKSNITIFRNVATQEITAANGK
VDGIVYQDRASGETRTQPLHGVFVQIGLVPNSGFLGDLVEKTRFGEIVIDARGQTSEPGI
YACGDVTTVPYKQIVVAMGEGAKASLAAFDYLLKESDRLEALHADTESVSLAKAS
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcaaagacattctggcagccctcagccagtacaccgcaaacattgcgacacct
gtggctttcgtgctgcagaccggtcaacacaccaagcgcgacgaactggtgacattcctt
aacgacttcgcaagcgtgagcgagcacctgagcctgcgcgagcaggacgccggccttcgc
agtcccgtgaccttcacgcttgaagtggacggcgagcacaccggcatcgaattttccggc
atccccagtggccacgaattcaattcgctggtactggcggtattgcacgccaccggcacc
cccatgaagctcgatgaaagcctgaaggccatgctggcacgcgtggacgagccgctgcac
tttgaagccttcatcagtctttcctgccacaactgcccggacgtggtgcaggcgctgaac
cagttcgcactaattaacccgaacatccgcgccgagatgattgacggcgggctgtttcag
gacgtgatcaaagcgcgcgacattcagggtgtgcccactgtgtacctgaacggcgaactc
tttgccaacggcaaggtagacgccgcccagttgattgaaaaactgctggcccgctatccg
cacctggccgacggcaacaacgccgaacagctgccactgcaggacgtgaccatcattggt
ggtggcccagccggcatcagcagtgccatctacagtgcgcgcaaaggcctgaaagtcaca
ttgattgccgatcgcatcggtggccaggtgaaagacaccatgggcatcgagaatctgatc
ggcacacccaaaaccaccgggccggaattatcgggcgcgctgatgcagcacctgaatgat
tatgaggtcacggtcaaagaacatctcaaagtgagtgctgtggaaaagggcgatatcaaa
accctgacactctcatcgggagaagtgattcacaccaaaaccctgatcattgccaccggc
gccaaatggcgcgagctgggcatccccggcgaaaaggaaaatatcggcaacggcgtcgcc
tactgcccgcactgcgacggccccttcttcaaaggcaaagacgtggccgtgatcggtggc
ggcaactcgggcatcgaagcggcattggatctggccggtattgtgaaatcggtgaccgtg
ttcgaattcatgccggagttgaaagcggacaaggtgctggtggaaaaagcggagagcaaa
agcaacatcaccattttccgcaacgtggccacgcaggaaatcaccgctgccaacggcaaa
gtggacggcattgtgtatcaggatcgcgccagtggcgagacccgcacgcaacccctgcat
ggcgtatttgtacagattggcctggtgcccaacagcggttttctgggtgacctggtggag
aaaacccgcttcggtgaaattgtcatcgatgcgcgcgggcaaacctcagagcccggcatt
tatgcctgcggcgatgtgaccaccgtgccctataagcagattgtggtggccatgggcgaa
ggcgccaaggcatcactggcagcgtttgactacctgttgaaagaaagcgaccggttggaa
gccctgcacgcagacacagagtccgtgagcctggcaaaagcctcctga

DBGET integrated database retrieval system