KEGG   Streptococcus agalactiae 138spar: DN94_03580Help
Entry
DN94_03580        CDS       T03383                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sagc  Streptococcus agalactiae 138spar
Pathway
sagc00620  Pyruvate metabolism
sagc00680  Methane metabolism
sagc01100  Metabolic pathways
sagc01120  Microbial metabolism in diverse environments
sagc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DN94_03580
  Energy metabolism
   00680 Methane metabolism
    DN94_03580
Enzymes [BR:sagc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DN94_03580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF3288 FANCI_S1-cap
Motif
Other DBs
NCBI-ProteinID: AHX74794
UniProt: A0A2I6VWQ2
LinkDB All DBs
Position
663794..666589
Genome map
AA seq 931 aa AA seqDB search
MSHPKLESSSNKEIITEEVGLLKQLLDEATQKLIGSESFDKIEKIVSLSSTDDYTGLKET
ISALSNEEMVIVSRYFSILPLLINISEDVDLAYEINYKNNLNQDYLGKLSTTIDVVAGHE
NAKDILEHVNVVPVLTAHPTQVQRKTVLELTSKIHDLLRKYRDVKAGIVNQEKWYADLRR
YIGIIMQTDTIREKKLKVKNEITNVMEYYNRSLIKAVTKLTAEYKALAAKKGIHLENPKP
LTMGMWIGGDRDGNPFVTAETLRLSAMVQSEVIINHYIEQLNELYRNMSLSISLTEVSPE
LVTLANQSQDNSVYRENEPYRKAFNFIQDKLVQTLLNLKVGSYPKEKFVSRQESSDIVGR
YIKSHIAQVASDIQTEELPAYATAEEFKQDLLLVKQSLVQHGQDSLVDGELACLIQAVDI
FGFYLATIDMRQDSSINEACVAELLKSANIVDDYSSLSEEEKCQLLLKELTEDPRTLSST
HAPKSELLQKELAIFQTARELKDQLGEDIIKQHIISHTESVSDMFELAIMLKEVGLIDAN
QARIQIVPLFETIEDLDNSRDIMTQYLHYELVKKWVATNNNYQEIMLGYSDSNKDGGYLS
SGWTLYKAQNELTKIGEENGIKITFFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTE
QGEIIENKYGNQDAAYYNLEMLISASIDRMVTRMITNPNEIDNFRETMDGIVAESNAVYR
NLVFDNPYFYDYFFEASPIKEVSSLNIGSRPAARKTITEISGLRAIPWVFSWSQNRIMFP
GWYGVGSAFKHFIEQDEANLAKLQTMYQKWPFFNSLLSNVDMVLSKSNMNIALQYAQLAG
SKEVRDVFNIILNEWQLTKDMILAIEQHDNLLEENPMLHASLDYRLPYFNVLNYVQIELI
KRLRSNQLDEDYEKLIHITINGIATGLRNSG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccacccgaaattagaaagtagtagcaataaagaaatcattaccgaagaggtcggt
ttactgaagcaacttttggatgaagcaacgcaaaaattgattggtagtgaatcatttgac
aagattgaaaaaatagtttcattatcatcaactgacgattatactggtctgaaggaaact
atttcggctttaagcaacgaggagatggttattgtttctcgttacttctctattttgccg
ctcttaattaatatttcagaagacgttgatttagcatatgaaattaattataaaaataat
cttaaccaagattacctaggaaagttatcaacgactattgatgttgtagctggccatgaa
aatgctaaagatattcttgaacacgtcaatgttgtgcctgtgctaacagctcatcctact
caggtgcagcgtaaaacggtgctcgaattaacgtctaagattcatgatttattacgtaaa
tacagagatgtcaaagcaggaatcgtgaatcaagaaaaatggtatgctgacttgcgtcgt
tacatcggcattatcatgcaaacagacactattcgtgagaaaaaattgaaagtcaaaaat
gagataaccaatgtaatggaatattacaaccgttctcttattaaagcagttaccaaatta
acagcagaatataaggcactggcagctaaaaaaggtattcacttggagaatcctaagcct
ctgactatggggatgtggattggtggtgatagagatggcaatccctttgtaactgctgag
acactaagattatcagctatggtacaaagtgaagtgattattaaccattatattgagcag
ctaaatgagctttatcgtaatatgtcactttcaataagtctaactgaagtctctcccgaa
cttgttacattggcaaaccagtcacaagataattcggtatatagggaaaatgaaccttac
cgtaaagctttcaattttatccaagataaactagtacaaaccctactaaatttaaaagtt
ggttcttacccaaaagagaaatttgttagtcgtcaagaatcttctgatattgtaggaagg
tatataaaatcacatatcgctcaagtagcttctgacatacagacagaagaactaccagca
tacgctactgctgaggagtttaaacaagatttgttacttgtgaagcaatctttagttcaa
catggacaagattctcttgtcgatggcgaattagcttgtcttattcaagcagtagatatc
tttggattttatttagctactattgatatgcgtcaagattctagtattaatgaagcttgt
gtagcagaattattgaagtctgccaatattgtagatgattacagttctctttcagaagaa
gaaaaatgtcaacttctcttaaaagaattaacagaagatcctagaacattatcttctacg
catgctcctaaatccgagttacttcaaaaagaattggctattttccaaacagcacgtgag
ttaaaagatcaattgggtgaagacattataaaacagcatatcatttctcacacagagagc
gtttcggatatgtttgagttagctatcatgttaaaagaagttggactaattgatgccaat
caagctcgtattcagattgtaccgttatttgaaaccatcgaagatttggataattcacgt
gatattatgacccagtatctacattatgaattagttaaaaaatgggttgctactaacaac
aattatcaagaaataatgctaggttattcagatagtaataaagatggtggctatttatca
tctggttggactctatataaagctcaaaatgagctaacaaaaataggtgaagaaaatggt
attaaaatcacatttttccacggtcgtggtggaactgttggtcgtggtggtggtccatct
tatgaagctatcacatcacaaccttttggttcaatcaaagatcgaattcgcctaacagag
caaggtgaaatcattgagaataaatatggtaatcaagatgcagcctattataaccttgaa
atgcttatttcagcttccatagaccgcatggtaacacgtatgattactaaccctaatgaa
attgataatttccgtgagacaatggatggtattgtggctgaaagtaatgctgtttataga
aatttagtttttgataatccttatttctatgactatttctttgaagcaagtccaattaaa
gaggtatcaagtttaaatattggttctcggccagcagcacgtaaaacaattacagaaatt
tcaggtttacgtgcaattccatgggtattttcatggtcacaaaatcgtattatgtttccg
ggttggtatggtgttgggtcagccttcaagcactttattgaacaagatgaggcaaactta
gcaaaattacaaaccatgtatcaaaaatggccattctttaattctcttttatctaatgta
gatatggttttatcaaaatcaaatatgaatattgcgcttcagtatgctcagttagctgga
agtaaagaagttcgagatgtttttaatatcatccttaatgaatggcagttaactaaagat
atgattttagctattgaacagcatgataatttattagaagaaaatccaatgttacatgca
agtttagattatcgtttgccatatttcaatgttttgaattatgttcaaattgaattgatt
aaacgtcttcgtagtaaccaactagatgaagactatgagaagttgattcatattactatt
aatggtattgcaacaggtttacgaaattcaggttaa

DBGET integrated database retrieval system