KEGG   Streptococcus agalactiae 138spar: DN94_03615Help
Entry
DN94_03615        CDS       T03383                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sagc  Streptococcus agalactiae 138spar
Pathway
sagc00473  D-Alanine metabolism
sagc00550  Peptidoglycan biosynthesis
sagc01100  Metabolic pathways
sagc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sagc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DN94_03615
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DN94_03615
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DN94_03615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sagc01011]
    DN94_03615
Enzymes [BR:sagc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DN94_03615
Peptidoglycan biosynthesis and degradation proteins [BR:sagc01011]
 Precursor biosynthesis
  Amino acid ligase
   DN94_03615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK REC114-like
Motif
Other DBs
NCBI-ProteinID: AHX74801
LinkDB All DBs
Position
674245..675291
Genome map
AA seq 348 aa AA seqDB search
MSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFITQVGQFIKTQEFDEMPS
SDEKLMTNQTVDLDKMVRPSDIYDDNAIVFPVLHGPMGEDGSIQGFLEVLRMPYVGTNIL
SSSVAMDKITTKQVLATVGVPQVAYQTYFEGDDLEHAIKLSLETLSFPIFVKPANMGSSV
GISKATDESSLRSAIDLALKYDSRILIEQGVTAREIEVGILGNNDVKTTFPGEVVKDVDF
YDYDAKYIDNKITMDIPAKVDEATMEAMRQYASKAFKAIGTCGLSRCDFFLTKDGQIFLN
ELNTMPGFTQWSMYPLLWENMGLTYSDLIEKLVMLAKEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaacattgatcttgctttacggtggtcgctctgcggaacgtgaagtatct
gtactgtctgcagaaagcgtcatgcgtgctattaattatgataaattttttgttaaaact
tattttatcacgcaagtaggtcaatttattaaaacacaagaatttgatgaaatgccatct
tcagatgaaaagttaatgacaaaccaaactgttgatttagacaaaatggttcgtccaagt
gatatctatgatgataatgcaattgttttccccgttttacatggaccaatgggggaagat
ggttctatccaaggatttttagaagttttaaggatgccttatgttgggactaatattcta
tcttcaagcgtggctatggataaaattacaacaaaacaagtccttgcaacagtaggtgta
cctcaggttgcatatcaaacttattttgagggtgatgatttggaacatgcgattaaactc
tctttagaaactttaagtttcccaatttttgtaaaaccggctaatatggggtcatcagta
ggtatttcaaaagcgacagatgaatcctcacttcgctctgcaattgacttagctctcaag
tatgatagccgtattttgattgaacaaggcgtgacagctcgtgaaattgaagtaggtatt
ttaggcaataatgatgttaagacaacttttcctggcgaagttgttaaagacgtcgatttc
tatgactatgacgccaaatatattgataataaaattactatggatattccagctaaagtt
gatgaagcaactatggaagcaatgcgtcaatatgcaagtaaagcttttaaagcaatcggg
acttgtggtttatcacgctgtgatttctttttgacgaaagatggacaaatcttcttaaac
gaactgaatacaatgcccggttttactcagtggtcaatgtatcctctgctttgggaaaat
atggggctaacttatagtgatttgattgaaaagttagttatgttagctaaagaaatgttt
gaaaaacgtgagagtcatttaatttaa

DBGET integrated database retrieval system