KEGG   Streptococcus agalactiae NGBS061: EN72_04285Help
Entry
EN72_04285        CDS       T03516                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sage  Streptococcus agalactiae NGBS061
Pathway
sage00500  Starch and sucrose metabolism
sage01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sage00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EN72_04285
Enzymes [BR:sage01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EN72_04285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AIF86298
UniProt: A0A0E1EGF4
LinkDB All DBs
Position
767077..768543
Genome map
AA seq 488 aa AA seqDB search
MTNELIMQAFEWYLPSDGNHWKKLEGSISDLKKLGVSKIWLPPAFKGTSSDDVGYGVYDL
FDLGEFDQNGTIRTKYGRKEEYLKLIKSLKANGIKPFADIVLNHKANGDHKEKFQVIKVN
PENRQEALSEPYEIEGWTGFDFPGRQGEYNDFKWHWYHFTGLDYDAKNNETDIFMIVGDN
KGWADDDLIDDENGNFDYLMYNDIDFKNPEVIKNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFINDIRTKIKPDLEVFGEYWKSDQTSMKDYLEATQFQFSLVDVTLHMNFFDASH
QNRDFDMRTIFDDSLVIDNPEYAVTFVENHDTQSGQALESRVEDWFKPLAYGLILLRQQG
TPCLFYGDYYGIQGEFGQPSFKEIIDKMTELRQNYVFGKQVDYFTHSNCIGWTCLGDEEH
NSCLAVVLTNGDQGWKHMEVGEIYAGKTFVDYLGNCEQEVVIGDDGWGDFLVASASISAW
VPKIEEAN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaattgataatgcaagcttttgagtggtatttacctagtgatgggaatcac
tggaagaaattagagggctctatatcagaccttaaaaaacttggagttagtaaaatctgg
ttaccaccagcatttaagggaactagcagtgatgatgtaggatatggtgtttatgatctc
tttgatttaggagaatttgaccagaatggaacaattagaacaaaatatggtaggaaagaa
gagtatctaaagcttattaagtcgttaaaggcaaatggcattaaaccgtttgcagatatc
gttcttaaccataaagccaatggtgatcataaagaaaaatttcaagtcatcaaagtcaat
cctgaaaatcgtcaagaagcattaagtgaaccctatgaaattgaaggatggacgggattt
gatttcccaggtagacagggtgagtacaatgattttaaatggcactggtaccactttact
ggtttagattacgatgctaaaaataatgaaacagacatctttatgattgtaggcgataat
aaaggttgggcagacgatgatttgattgatgatgaaaatggtaatttcgattatctcatg
tacaatgacattgattttaagaatcctgaagttataaaaaacttacaagattgggctaag
tggtttattgaaactaccggtattgaaggttttcgtttggatgctgtgaaacatatcgat
tcttactttattcaaactttcattaatgatattcgtacaaaaataaaacccgatttagag
gtctttggcgaatattggaaatctgaccaaacatcaatgaaggactatttagaggcaaca
caatttcaattttctcttgttgatgttaccttacatatgaatttttttgatgccagtcac
caaaaccgtgattttgatatgcgaacaatttttgatgatagtcttgttattgataatcct
gagtatgctgttacattcgtagaaaatcacgatacgcaaagtggacaagctctagaaagt
agagtggaagattggtttaagcctttagcttatggcttgatacttttacgccaacaaggg
actccatgtcttttttatggtgattactatggcattcaaggagaatttggtcaaccatcc
tttaaagagattattgataaaatgactgagctacgccaaaactatgtatttggcaaacaa
gtcgattattttacgcattcaaattgtattggttggacttgtcttggggatgaggaacat
aattcttgtttagctgtggtcctaacaaatggtgatcagggatggaaacatatggaagta
ggggaaatttatgcaggcaaaacttttgttgattatttaggcaattgtgaacaagaggtt
gttataggagatgatggttggggtgattttttagttgcatctgcgtctatctcggcttgg
gtccctaaaatagaggaagctaactga

DBGET integrated database retrieval system