KEGG   Streptococcus agalactiae NGBS061: EN72_04575Help
Entry
EN72_04575        CDS       T03516                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sage  Streptococcus agalactiae NGBS061
Pathway
sage00473  D-Alanine metabolism
sage00550  Peptidoglycan biosynthesis
sage01100  Metabolic pathways
sage01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sage00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    EN72_04575
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EN72_04575
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    EN72_04575
Enzymes [BR:sage01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EN72_04575
Peptidoglycan biosynthesis and degradation proteins [BR:sage01011]
 Precursor biosynthesis
  Amino acid ligase
   EN72_04575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK REC114-like
Motif
Other DBs
NCBI-ProteinID: AIF86355
UniProt: A0A0E1EGL9
LinkDB All DBs
Position
828297..829343
Genome map
AA seq 348 aa AA seqDB search
MSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFITQVGQFIKTQEFDEMPS
SDEKLMTNQTVDLDKMVRPSDIYDDNAIVFPVLHGPMGEDGSIQGFLEVLRMPYVGTNIL
SSSVAMDKITTKQVLATVGVPQVAYQTYFEGDDLEHAIKLSLETLSFPIFVKPANMGSSV
GISKATDESSLRSAIDLALKYDSRILIEQGVTAREIEVGILGNNDVKTTFPGEVVKDVDF
YDYDAKYIDNKITMDIPAKVDEATMEAMRQYASKAFKAIGACGLSRCDFFLTKDGQIFLN
ELNTMPGFTQWSMYPLLWENMGLTYSDLIEKLVMLAKEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaacattgatcttgctttacggtggtcgctctgcggaacgtgaagtatct
gtactgtctgcagaaagcgtcatgcgtgctattaattatgataaattttttgttaaaact
tattttatcacgcaagtaggtcaatttattaaaacacaagaatttgatgaaatgccatct
tcagatgaaaagttaatgacaaaccaaactgttgatttagacaaaatggttcgtccaagt
gatatctatgatgataatgcaattgttttccccgttttacatggaccaatgggggaagat
ggttctatccaaggatttttagaagttttaaggatgccttatgttgggactaatattcta
tcttcaagcgtggctatggataaaattacaacaaaacaagtccttgcaacagtaggtgta
cctcaggttgcatatcaaacttattttgagggtgatgatttggaacatgcgattaaactc
tctttagaaactttaagtttcccaatttttgtaaaaccggctaatatggggtcatcagta
ggtatttcaaaagcgacagatgaatcctcacttcgctctgcaattgacttagctctcaag
tatgatagccgtattttgattgaacaaggcgtgacagctcgtgaaattgaagtaggtatt
ttaggcaataatgatgttaagacaacttttcctggcgaagtcgttaaagacgtcgatttc
tatgactatgacgccaaatatattgataataaaattactatggatattccagctaaagtt
gatgaagcaactatggaagcaatgcgtcaatatgcaagtaaagcttttaaagcaatcggg
gcttgtggtttatcacgctgtgatttctttttgacgaaagatggacaaatcttcttaaac
gaactgaatacaatgcccggttttactcagtggtcaatgtatcccctgctttgggaaaat
atggggctaacttatagtgatttgattgaaaagttagttatgttagctaaagaaatgttt
gaaaaacgtgagagtcatttaatttaa

DBGET integrated database retrieval system