KEGG   Streptococcus agalactiae NGBS572: EN73_02935Help
Entry
EN73_02935        CDS       T03517                                 

Definition
(GenBank) carbohydrate kinase
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
sagg  Streptococcus agalactiae NGBS572
Brite
KEGG Orthology (KO) [BR:sagg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EN73_02935
Enzymes [BR:sagg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     EN73_02935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AIF88161
UniProt: A0A3A6Q493
LinkDB All DBs
Position
533920..534756
Genome map
AA seq 278 aa AA seqDB search
MIVGEQEARALIKPRPKSSHKGDYGSVLLIGGFYPYGGAIIMAALACVKTGAGLVTVATQ
SCNIPSLHSQLPEVMAFDSDDYKWLEKSIVQSDVIVIGPGLGVSESSRKILNQTMEKIQS
HQSVIIDGSALTLLSEGAFPQTKAKNLVLTPHQKEWERLSGIAVSQQTKENTQTALKSFP
KGTILVAKSSHTRIFQDLDEKEIIVGGPYQATGGMGDTLCGMIAGMLAQFKEASPLDKVS
VGVYLHSAIAQELSKEAYVVLPTTISDEIPKEMARLSK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgattgttggtgaacaagaagcgagggcgttaattaagccacgccctaaatcaagccat
aaaggtgattatggtagtgttcttctgataggaggtttttatccctatggaggtgctatt
ataatggcagctttggcctgtgtcaaaactggtgcaggattagttactgtagcaacccaa
agttgcaatatcccctctttgcatagtcaactgccagaggtaatggcgtttgatagtgat
gattacaaatggttggaaaaatcaattgttcaaagtgatgttattgtaattggtcctgga
ttaggagtatcagaatcatctcgaaaaatcttgaaccagaccatggagaagattcaatca
catcaaagtgtcatcattgatggatcagccttgactctgttatcagaaggtgcgtttccg
caaacaaaggctaaaaatttagtgttgacacctcatcaaaaagaatgggagcgattgtca
ggtattgctgtatcgcaacagacaaaagaaaatacccaaaccgctcttaagtcttttccc
aaaggaacgatcttagtcgctaagagttcgcatacgcgtatttttcaagatttagacgaa
aaagaaattatagtaggaggtccttaccaggcgactggagggatgggggatactttgtgt
ggtatgattgcaggtatgttagcgcaatttaaagaagcctctcctctagataaggtatca
gtgggagtttatctacattcggcaattgctcaagaattatctaaggaagcctacgttgtt
ctaccgacaacgattagtgatgagattccaaaagaaatggctagactatctaaataa

DBGET integrated database retrieval system