KEGG   Streptococcus agalactiae NGBS572: EN73_04240Help
Entry
EN73_04240        CDS       T03517                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sagg  Streptococcus agalactiae NGBS572
Pathway
sagg00620  Pyruvate metabolism
sagg00680  Methane metabolism
sagg01100  Metabolic pathways
sagg01120  Microbial metabolism in diverse environments
sagg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EN73_04240
  09102 Energy metabolism
   00680 Methane metabolism
    EN73_04240
Enzymes [BR:sagg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EN73_04240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF3288 FANCI_S1-cap
Motif
Other DBs
NCBI-ProteinID: AIF88399
LinkDB All DBs
Position
765474..768269
Genome map
AA seq 931 aa AA seqDB search
MSHPKLESSSNKEIITEEVGLLKQLLDEATQKLIGSESFDKIEKIVSLSSTDDYTGLKET
ISALSNEEMVIVSRYFSILPLLINISEDVDLAYEINYKNNLNQDYLGKLSTTIDVVAGHE
NAKDILEHVNVVPVLTAHPTQVQRKTVLELTSKIHDLLRKYRDVKAGIVNQEKWYADLRR
YIGIIMQTDTIREKKLKVKNEITNVMEYYNRSLIKAVTKLTAEYKALAAKKGIHLENPKP
LTMGMWIGGDRDGNPFVTAETLRLSAMVQSEVIINHYIEQLNELYRNMSLSISLTEVSPE
LVTLANQSQDNSVYRENEPYRKAFNFIQDKLVQTLLNLKVGSYPKEKFVSRQESSGIVGR
YIKSHIAQVASDIQTEELPAYATAEEFKQDLLLVKQSLVQHGQDSLVDGELACLIQAVDI
FGFYLATIDMRQDSSINEACVAELLKSANIVDDYSSLSEEEKCQLLLKELTEDPRTLSST
HTPKSELLQKELAIFQTARELKDQLGEDIIKQHIISHTESVSDMFELAIMLKEVGLIDAN
QARIQIVPLFETIEDLDNSRDIMTQYLHYGLVKKWITTNNNYQEIMLGYSDSNKDGGYLS
SGWTLYKAQNELTKIGEENGIKITFFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTE
QGEIIENKYGNQDAAYYNLEMLISASIDRMVTRMITNLNEIDNFRETMDGIVAESNAVYR
NLVFDNPYFYDYFFEASPIKEVSSLNIGSRPAARKTITEISGLRAIPWVFSWSQNRIMFP
GWYGVGSAFKQFIEQDEANLAKLQTMYQKWPFFNSLLSNVDMVLSKSNMNIALQYAQLAG
SKEVRDVFNIILNEWQLTKDMILAIEQHDNLLEENPMLHASLDYRLPYFNVLNYVQIELI
KRLRSNQLDEDYEKLIHITINGIATGLRNSG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccacccgaaattagaaagtagtagcaataaagaaatcattaccgaagaggtcggt
ttactgaagcagcttttggatgaagcaacgcaaaaattgattggtagtgaatcatttgac
aagattgaaaaaatagtttcattatcatcaactgacgattatactggtttgaaggaaact
atttcggctttaagcaacgaggagatggttattgtttctcgttacttctctattttgccg
ctcttaattaatatttcagaagacgttgatttagcatatgaaattaattataaaaataat
cttaaccaagattacctaggaaagttatcaacgactattgatgttgtagctggccatgaa
aatgctaaagatattcttgaacacgtcaatgttgtgcctgtgctaacagctcatcctact
caggtgcagcgtaaaacggtgctcgaattaacgtctaagattcatgatttattacgtaaa
tacagagatgtcaaagcaggaatcgtgaatcaagaaaaatggtatgctgacttgcgtcgt
tacatcggcattatcatgcaaacagacactattcgcgagaaaaaattgaaagtcaaaaat
gagataaccaatgtaatggaatattacaaccgttctcttattaaagcagttaccaaatta
acagcagaatataaggcactggcagctaaaaaaggtattcacttagagaatcctaagcct
ctgactatggggatgtggattggtggtgatagagatggcaatccctttgtaactgctgag
acactaagattatcagctatggtacaaagtgaagtgattattaaccattatattgagcag
ctaaatgaactttatcgtaatatgtcactttcaataagtctaactgaagtctctcccgaa
cttgttacgttggcaaaccagtcacaagataattcagtatatagggaaaatgaaccttat
cgtaaagctttcaattttatccaagataaactagtacaaaccctactaaatttaaaagtt
ggttcttacccaaaagagaaatttgttagtcgccaagaatcttctggtattgtaggaagg
tatataaaatcacatatcgctcaagtagcttctgacatacagacagaagaactaccagca
tacgctactgctgaggagtttaaacaagatttgttacttgtgaagcaatctttagttcaa
catggacaagattctcttgtcgatggcgaattagcttgtcttattcaagcagtagatatc
tttggattttatttagctactattgatatgcgtcaagattctagtattaatgaagcttgt
gtagcagaattattgaagtctgccaatattgtagatgattacagttctctttcagaagaa
gaaaaatgtcaacttctcttaaaagaattaacagaagatcctagaacattatcttctacg
catactcctaaatccgagttacttcaaaaagaattggctattttccaaacagcacgtgag
ttaaaagatcaattgggtgaagacattataaaacagcatatcatttctcacacagagagc
gtttcggatatgtttgagttagctatcatgttaaaagaagttggactaattgatgccaat
caagctcgcattcagattgtaccgttatttgaaaccatcgaagatttggataattcacgt
gatattatgacccagtatctacattatggattagtaaaaaaatggattacaactaacaac
aattatcaagaaataatgctaggttattcagatagtaataaagatggtggctatttatca
tctggttggactctatataaagctcaaaatgagctaacaaaaataggtgaagaaaacggt
attaaaatcacatttttccacggtcgtggtggaactgttggtcgtggtggtggtccatct
tatgaagctatcacatcacaaccttttggttcaatcaaagatcgaattcgcctaacagag
caaggtgaaatcattgagaataaatatggtaatcaagatgcagcctattataaccttgaa
atgcttatttcagcttccatagaccgcatggtaacacgtatgattactaaccttaatgaa
attgataatttccgtgagacaatggatggtattgtggctgaaagtaatgccgtttataga
aatttagtttttgataatccttatttctatgactatttctttgaagcaagtccaattaaa
gaggtatcaagtttaaatattggttctcggccagcagcacgtaaaacaattacagaaatt
tcaggtttacgtgcaattccatgggtattttcatggtcacaaaatcgtattatgtttccg
ggttggtatggtgttgggtcagccttcaagcaatttattgaacaagatgaggcaaactta
gcaaaattacaaaccatgtatcaaaaatggccattctttaattctcttttatctaatgta
gatatggttttatcaaaatcaaatatgaatattgcgcttcagtatgctcagttagctgga
agtaaagaagttcgagatgtttttaatatcatccttaatgaatggcagttaactaaagat
atgattttagctattgaacagcatgataatttattagaagaaaacccaatgttacatgca
agtttagattatcgtttgccatatttcaatgttttgaattatgttcaaattgaattgatt
aaacgtcttcgtagtaaccaactagatgaagactatgagaagttgattcatattactatt
aatggtattgcaacaggtttacgaaattcaggttaa

DBGET integrated database retrieval system