KEGG   Streptococcus agalactiae NGBS572: EN73_08530Help
Entry
EN73_08530        CDS       T03517                                 

Definition
(GenBank) cysteine ABC transporter ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
sagg  Streptococcus agalactiae NGBS572
Pathway
sagg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sagg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EN73_08530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sagg02000]
    EN73_08530
Transporters [BR:sagg02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    EN73_08530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 DUF87 RsgA_GTPase AAA_16 MMR_HSR1 ABC_membrane AAA_18 AAA_25
Motif
Other DBs
NCBI-ProteinID: AIF89229
UniProt: A0A1A9E2Z6
LinkDB All DBs
Position
complement(1663240..1664988)
Genome map
AA seq 582 aa AA seqDB search
MFKIPLFKELKTDQWVKPFFKQYKVSLVIALFLGFMTFFSASALMFNSGYLISKSASLPS
NILLVYVPIVLTRAFGIGRPVFRYIERLTSHNWVLRMTSQLRLKLYHSLESNAIFMKRDF
RLGDVMGLLAEDINYLQNLYLRTIFPTIIAWLLYSFIIIATGFFSLWFALMMLLYLAIMI
FLFPLWSILANGARQTREKELKNHLYTDLTDNVLGISDWIFSQRGQEYVALHERSESELM
AVQKKIRSFNNRRALIVELVFGFLAILVIIWASNQFIGHRGGEANWIAAFVLTVFPLSEA
FAGLSAAAQETNKYSDSIHRLNELSETYFETTQNQLPNKPYDFSVKNLSFQYKPQEKWVL
HHLDLDIKEGEKIAILGRSGSGKSTLASLLRGDLKASQGKITLGGADVSIVGDCISNYIG
VIQQAPYLFNTTLLNNIRIGNQDASEEDVWKVLERVGLKEMVTDLSDGLYTMVDEAGLRF
SGGERHRIALARILLKDVPIVILDEPTVGLDPITEQALLRVFMKELEGKTLVWITHHLKG
IEHADRILFIENGQLELEGSPQELSQSSQRYRQLKAADDGDL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaatccctttgtttaaagaattaaagacagatcaatgggtaaaaccatttttc
aaacaatataaagtttccttagtaattgctcttttccttggttttatgactttcttttct
gccagtgctcttatgtttaattcgggctatctgattagtaagtcagcttcactaccgagt
aatattcttctagtatatgttccaattgtactaacacgtgcttttggtattggacgtcct
gtttttcgttatatagaacgcctaacgagtcacaattgggtattacgaatgacttcacaa
ctgcgcttgaagctttaccattccttagaaagcaatgctatctttatgaagcgtgatttt
cgtttaggagatgttatggggcttttagcggaggatattaattatttgcaaaatttgtat
cttaggacaatatttccaacgattatagcgtggttattatatagctttattattattgca
acaggcttcttttctctatggtttgctttaatgatgttgctttatttagctattatgatt
tttctttttccactttggtcgattttagctaatggtgctcgtcagactcgtgaaaaagaa
ttaaaaaatcatctttatactgatttgacggataatgtcttaggtatttcagactggatt
tttagtcaacgtggtcaagagtacgtcgccttgcatgaacgttcggaaagtgaactaatg
gctgttcagaaaaaaattcgttcctttaataatcgtagagctcttattgtggaattagtt
tttggctttctagctattttggttattatttgggctagtaatcagtttattggtcacaga
ggtggcgaagctaactggattgcagcatttgttctaacagtatttcccttgtcagaggca
tttgctggtttgtctgctgctgctcaagaaacaaataaatattctgattcaattcatcgt
cttaatgaattatcagaaacgtattttgaaacaactcaaaatcaattgcctaataagcca
tatgatttttccgtcaagaatttaagtttccagtataagccacaagagaaatgggttttg
catcatttagatttggatattaaagaaggagaaaaaattgctattttagggcggagtggt
tctggcaagagtaccttagctagtctacttcgtggcgacttgaaagcaagtcaagggaag
attaccctaggcggtgctgatgtttcaatagttggtgattgcatttctaactatattgga
gtgatacaacaagcgccctacctttttaatacaaccctgctaaataacattcgcattgga
aaccaagatgctagtgaagaagatgtatggaaagttcttgaacgagttggattgaaagag
atggtcactgatttatcagatggtctctatacaatggttgatgaagctggacttaggttt
tcaggtggcgaaaggcatagaattgctttggctagaatcttactaaaagatgtcccaatt
gttatcttagatgagccaactgttggacttgatcctattactgaacaagccttactaagg
gtatttatgaaagaattggaaggtaagaccttagtttggattacacatcacttaaaaggt
attgaacatgctgatcgtatcttatttatagaaaatgggcaattagagttggaaggttct
cctcaagaattgtctcaaagtagtcaacgttaccgtcagctgaaagccgctgatgatggt
gatctatga

DBGET integrated database retrieval system