KEGG   Streptococcus agalactiae ILRI005: MSA_10640Help
Entry
MSA_10640         CDS       T02704                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00010  Glycolysis / Gluconeogenesis
sagi00030  Pentose phosphate pathway
sagi00051  Fructose and mannose metabolism
sagi00052  Galactose metabolism
sagi00680  Methane metabolism
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01130  Biosynthesis of antibiotics
sagi01200  Carbon metabolism
sagi01230  Biosynthesis of amino acids
sagi03018  RNA degradation
Module
sagi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSA_10640
   00030 Pentose phosphate pathway
    MSA_10640
   00051 Fructose and mannose metabolism
    MSA_10640
   00052 Galactose metabolism
    MSA_10640
  09102 Energy metabolism
   00680 Methane metabolism
    MSA_10640
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    MSA_10640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sagi01009]
    MSA_10640
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sagi03019]
    MSA_10640
Enzymes [BR:sagi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MSA_10640
Protein phosphatases and associated proteins [BR:sagi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MSA_10640
Messenger RNA biogenesis [BR:sagi03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MSA_10640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CCW39925
LinkDB All DBs
Position
954006..955028
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINQGYYGMVTGDIFPLDANSVGDT
INRGGTFLRSARYPEFAELEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVATAVENLDRLRDTSASHNRTFVVEVMGRNAGDIALWS
GIAAGADQIIVPEEEFNIDEVVSNVRAGYAAGKHHQIIVLAEGVMSGDEFAKTMKAAGDD
SDLRVTNLGHLLRGGSPTARDRVLASRMGAYAVQLLKEGRGGLAVGVHNEEMVESPILGL
AEEGALFSLTDEGKIVVNNPHKADLRLAALNRDLANQSSK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggtggtgacgcccctggtatgaacgctgctatc
cgtgcagttgttcgtaaagcaatttctgaaggtatggaagtttacggcatcaaccaaggt
tactatggtatggtgacaggggatattttccctttggatgctaattctgttggggatact
atcaaccgtggaggaacgtttttacgttcagcacgttatcctgaatttgctgaacttgaa
ggtcagcttaaagggattgaacagcttaaaaaacacggtattgaaggtgtagtagttatc
ggtggtgatggttcttatcatggtgctatgcgtctaactgagcacggtttcccagctgtt
ggtttgccgggtacaattgataacgatatcgttggcactgactatactattggttttgac
acagcagttgcgacagcagttgagaatcttgaccgtcttcgtgatacatcagcaagtcat
aaccgtacttttgttgttgaggttatgggaagaaatgcaggagatatcgctctttggtca
ggtatcgctgcaggtgcagatcaaattattgttcctgaagaagagttcaatattgatgaa
gttgtctcaaatgttagagctggctatgcagctggtaaacatcaccaaatcatcgtcctt
gcagaaggtgttatgagtggtgatgagtttgcaaaaacaatgaaagcagcaggagacgat
agcgatcttcgtgtgacgaatttaggacatctgctccgtggtggtagtccgactgctcgt
gatcgtgtcttagcatctcgtatgggagcgtacgctgttcaattgttgaaagaaggtcgt
ggcggtttagccgttggtgtccacaacgaagaaatggttgaaagtccaattttaggttta
gcagaagaaggtgctttgttcagcttgactgatgaaggaaaaatcgttgttaataatccg
cataaagcggaccttcgcttggcagcacttaatcgtgaccttgccaaccaaagtagtaaa
taa

DBGET integrated database retrieval system