KEGG   Streptococcus agalactiae ILRI005: MSA_12150Help
Entry
MSA_12150         CDS       T02704                                 

Definition
(GenBank) Ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00030  Pentose phosphate pathway
sagi00230  Purine metabolism
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01200  Carbon metabolism
sagi01230  Biosynthesis of amino acids
Module
sagi_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSA_12150
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MSA_12150
Enzymes [BR:sagi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     MSA_12150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: CCW40076
LinkDB All DBs
Position
1108422..1109396
Genome map
AA seq 324 aa AA seqDB search
MAEQYADKQIKLFSLTANREIAEKISQASGIPLGKMSSRQFSDGEIMINIEETVRGDDIY
IIQSTSFPVNDNLWELLIMIDACKRASANTVNIVVPYFGYSRQDRIAASREPITAKLVAN
MLVKAGVDRVLTLDLHAVQVQGFFDIPVDNLFTVPLFAEHYNQLGLSGEDVVVVSPKNSG
IKRARSLAEYLDSPIAIIDYAQDDSEREEGYIIGEVEGKKAIIIDDILNTGKTFAEAAKI
LERGGATEIYAVASHGLFAGGAADILESAPIREIIVTDSVLSKERIPSNIKYLTASHLIA
DAIIRIHERKPLSPLFSYRSDKKD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaatacgccgataaacaaatcaaacttttttcattaaccgctaatagagaa
attgctgaaaaaatttcccaagcttcaggaattcctttgggtaagatgtcatcacgtcaa
ttctctgatggcgaaattatgattaatattgaggaaacggtgcgcggtgacgatatctat
atcatccaatctacaagcttcccagtcaatgataatctctgggaattactcattatgatt
gacgcttgcaaacgtgcaagtgctaatactgttaacatcgtagtcccttattttggatac
tctcgtcaggaccgcatcgctgcatctcgtgaacctattactgcaaaattggtcgctaat
atgttagttaaagctggagttgatcgagttcttaccctcgacttacatgcagtacaagta
caagggttcttcgatatcccagttgacaatctttttactgtcccactatttgctgaacac
tataatcaactcggtctctctggtgaagatgtcgtcgttgttagtcctaaaaattctgga
atcaagcgtgctcgtagtttggcagaataccttgactctccaattgctatcattgattat
gcacaagatgattctgaacgtgaagaaggctatattattggtgaggtagaaggtaagaaa
gctattattattgatgatattttaaatacaggaaaaacctttgccgaagctgcaaaaatt
ttagaacgtggtggagcaactgagatttatgctgttgctagtcatgggctttttgctggc
ggcgcagctgatattttagagtctgcaccaattagagaaattatcgtaacagactctgtt
ttatctaaagagcgtattcctagcaatattaaatatctgacagctagccatctcattgca
gatgctattatccgtatccatgaaagaaaacctttaagtccattattttcatatcgttca
gataagaaggattaa

DBGET integrated database retrieval system